DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and ZSCAN32

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001271456.1 Gene:ZSCAN32 / 54925 HGNCID:20812 Length:697 Species:Homo sapiens


Alignment Length:408 Identity:86/408 - (21%)
Similarity:146/408 - (35%) Gaps:115/408 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 KDGDEADAED--EDDVEKPEDEDGTEEGDEAIEEDEDALDEDEDPNEEVEEIE-----PD---FE 204
            ::|.:.:|.:  ..:.|..|.||||.:|.:..|:|      ..:|.:||.:::     |:   ||
Human   356 QEGSDIEAGELNHQNGEPTEVEDGTVDGADRDEKD------FRNPGQEVRKLDLPVLFPNRLGFE 414

  Fly   205 TGTDAEGELITGDEPGDLADVPIRERK--------------KEEPVDEDQCRVCTSKEELVCLFK 255
            ...:.:.|.:..|:..::......:||              :.||....|||....:.|      
Human   415 FKNEIKKENLKWDDSEEVEINKALQRKSRGVYWHSELQKGLESEPTSRRQCRNSPGESE------ 473

  Fly   256 KQIDATPADMLLVICPNVSILPKD-FMPQFICTK-CMGSLTIAIQLRKQLETTDQ--ELRKRLSR 316
               :.||:...:   .:.|...:| .....:|.| |..|:....:...:||...|  |..|..||
Human   474 ---EKTPSQEKM---SHQSFCARDKACTHILCGKNCSQSVHSPHKPALKLEKVSQCPECGKTFSR 532

  Fly   317 SKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDSADSDDSEKEKKKPGPRGR 381
            |...||..|.:.                                                     
Human   533 SSYLVRHQRIHT----------------------------------------------------- 544

  Fly   382 PRKKPLKRGTDSDGEPSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTH--ERIEHA 444
             .:||.|......|....:....:..:.|.. .|::|..|..:|::..|.::|::||  |: .:.
Human   545 -GEKPHKCSECGKGFSERSNLTAHLRTHTGE-RPYQCGQCGKSFNQSSSLIVHQRTHTGEK-PYQ 606

  Fly   445 CPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIF----RLRAELKHHMAQRHDEHGFIYECK 505
            |.:|||:|.....:..|.:.|..| :.::|.:|.|||    ...|..|.|..::.      |.|.
Human   607 CIVCGKRFNNSSQFSAHRRIHTGE-SPYKCAVCGKIFNNSSHFSAHRKTHTGEKP------YRCS 664

  Fly   506 RCQRTFLTQQRLQRHQAV 523
            .|:|.|.....|.|||.|
Human   665 HCERGFTKNSALTRHQTV 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 16/76 (21%)
zf-C2H2 416..438 CDD:278523 5/21 (24%)
C2H2 Zn finger 418..438 CDD:275368 5/19 (26%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 7/20 (35%)
C2H2 Zn finger 504..521 CDD:275368 6/16 (38%)
ZSCAN32NP_001271456.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
SCAN 33..142 CDD:128708
SCAN 33..121 CDD:280241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 144..177
KRAB_A-box 218..250 CDD:295379
Myb_DNA-bind_4 253..334 CDD:290549
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..395 11/44 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 451..482 8/39 (21%)
COG5048 <455..668 CDD:227381 58/287 (20%)
zf-C2H2 522..543 CDD:278523 9/20 (45%)
C2H2 Zn finger 523..543 CDD:275368 8/19 (42%)
zf-H2C2_2 535..559 CDD:290200 7/77 (9%)
C2H2 Zn finger 551..571 CDD:275368 1/19 (5%)
zf-H2C2_2 563..588 CDD:290200 5/25 (20%)
C2H2 Zn finger 579..599 CDD:275368 5/19 (26%)
zf-H2C2_2 591..616 CDD:290200 10/25 (40%)
C2H2 Zn finger 607..627 CDD:275368 6/19 (32%)
zf-H2C2_2 623..644 CDD:290200 8/21 (38%)
C2H2 Zn finger 635..655 CDD:275368 7/19 (37%)
zf-H2C2_2 647..671 CDD:290200 7/29 (24%)
zf-C2H2 661..683 CDD:278523 10/22 (45%)
C2H2 Zn finger 663..683 CDD:275368 9/20 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.