DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Plagl2

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_061277.2 Gene:Plagl2 / 54711 MGIID:1933165 Length:496 Species:Mus musculus


Alignment Length:276 Identity:67/276 - (24%)
Similarity:103/276 - (37%) Gaps:69/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 IQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVS-DVAGTTSAD 360
            ||..||.|....:|          |.||||               .|.:.:.|.. :::||..  
Mouse    12 IQDAKQEEEVGWKL----------VPRPRG---------------REAESQVKCQCEISGTPF-- 49

  Fly   361 SDSADSDDSEKEKKKPGPRGRPRKKPLKRGTDSDGEPSSAQKKKYQPSSTASV-GPFECPNCDLT 424
                    |..||.:|.....|.::|........|:..:::.|.|:..:|.|. .|.:|..||..
Mouse    50 --------SNGEKLRPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCDKM 106

  Fly   425 FSRKQSYVLHRKTHERIEHA--CPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFR-LRAE 486
            |.||.....|.:||:..:.|  |..|||.:..:..|:.|:..|........|::|.:.|. .:|.
Mouse   107 FHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQTFESTQAL 171

  Fly   487 LKHHMAQRHDEHGFIYE----CKRCQRTFLTQQRLQRHQAVG-------CQ-------------- 526
            |:|..|......|...|    |..|.|.|.|::.::||..|.       ||              
Mouse   172 LEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQYCAQRFGRKDHLTR 236

  Fly   527 ----RHKEDSVRIKEE 538
                .|.::.::||.|
Mouse   237 HVKKSHSQELLKIKTE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 6/15 (40%)
zf-C2H2 416..438 CDD:278523 7/21 (33%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-C2H2 443..465 CDD:278523 7/23 (30%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 6/17 (35%)
C2H2 Zn finger 504..521 CDD:275368 6/16 (38%)
Plagl2NP_061277.2 C2H2 Zn finger 42..62 CDD:275368 6/29 (21%)
C2H2 Zn finger 70..92 CDD:275368 3/21 (14%)
zf-H2C2_2 85..109 CDD:372612 8/23 (35%)
C2H2 Zn finger 100..120 CDD:275368 7/19 (37%)
C2H2 Zn finger 129..149 CDD:275368 6/19 (32%)
C2H2 Zn finger 158..178 CDD:275368 6/19 (32%)
C2H2 Zn finger 193..213 CDD:275368 7/19 (37%)
C2H2 Zn finger 221..239 CDD:275368 2/17 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.