Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001108106.1 | Gene: | PLAG1 / 5324 | HGNCID: | 9045 | Length: | 500 | Species: | Homo sapiens |
Alignment Length: | 241 | Identity: | 53/241 - (21%) |
---|---|---|---|
Similarity: | 83/241 - (34%) | Gaps: | 64/241 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 366 SDDSEKEKKKPGPRGRPRKKPLKRGTDS--DGEPSSAQKKKYQPSSTASVGPFEC--PNCDLTFS 426
Fly 427 RKQSYVLHRKTHE-RIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHH 490
Fly 491 MA---------------QRHDEHGFI-------------------YECKRCQRTFLTQQRLQRHQ 521
Fly 522 AVG-------CQ------------------RHKEDSVRIKEEQSRF 542 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156917 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |