DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp518b

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_008768453.1 Gene:Zfp518b / 498390 RGDID:1564150 Length:1077 Species:Rattus norvegicus


Alignment Length:219 Identity:41/219 - (18%)
Similarity:81/219 - (36%) Gaps:52/219 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 KKPGPRGRPRKKP----LKRGTDSDGE----PSSAQKKKYQ--PSSTASVGP------FECPNCD 422
            |:|....||.::.    |.:|::::..    .:..|.|...  |:.....||      :.|..|.
  Rat    30 KQPNRATRPERQEAQTLLYQGSEAEAATMTIATCVQCKSIHKIPTQDLRKGPGQGQDTYVCFKCS 94

  Fly   423 LTFSRKQSYVLHRK---THERIE--------------------HACPICGKKFKVEWAYKTHMQR 464
            |.....|.:.::..   .|.|.|                    :.|..|....|....|:.|..:
  Rat    95 LRAVPTQLHFVNNNAGAAHIRNETETISSPVNKFKVRNFKPGKYYCDKCRFSTKDPLQYRKHTLQ 159

  Fly   465 HEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHG--FIYECKRC-----QRTFLTQQRLQRHQA 522
            ||:.:  |.|..|..|...:.|.:.|:.    :|.  |.|.|:.|     :..::.:.|.:.|:.
  Rat   160 HEEIK--FICSHCSYISYTKGEFQRHLV----KHTGIFPYRCEYCDYGAIRNDYIVKHRRRVHER 218

  Fly   523 VGCQRHKEDSVRIKEEQSRFKQES 546
            .|.:|..:...:::.:::...::|
  Rat   219 AGAKRPFKTVAKLEPKRTNISKQS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 4/24 (17%)
C2H2 Zn finger 418..438 CDD:275368 4/22 (18%)
zf-C2H2 443..465 CDD:278523 5/21 (24%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 474..491 CDD:275368 4/16 (25%)
C2H2 Zn finger 504..521 CDD:275368 3/21 (14%)
Zfp518bXP_008768453.1 C2H2 Zn finger 140..160 CDD:275368 5/19 (26%)
C2H2 Zn finger 167..187 CDD:275368 5/23 (22%)
zf-H2C2_2 179..200 CDD:290200 7/24 (29%)
C2H2 Zn finger 195..216 CDD:275368 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350867
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.