DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and hb

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_731267.1 Gene:hb / 41032 FlyBaseID:FBgn0001180 Length:758 Species:Drosophila melanogaster


Alignment Length:309 Identity:65/309 - (21%)
Similarity:106/309 - (34%) Gaps:93/309 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 DEDEDPNEEVEEIEPDFETGTDAEGELITGDEPGDLAD-VPIRERKKEEPVDEDQCRVCTSKEEL 250
            ::.:..|||.|:         |.|.|..:.|...||:. .|::|       ||.|.:   .::.|
  Fly   518 NQQQSDNEEEEQ---------DDEYERKSVDSAMDLSQGTPVKE-------DEQQQQ---PQQPL 563

  Fly   251 VCLFKKQIDATPADMLLVICPNVS-----ILPKDFMPQFICTKCMGSLTIAIQLRKQLETTDQEL 310
            ....|.:.:|||    |:...|.|     :|..|.:               :|||.:..|:.::|
  Fly   564 AMNLKVEEEATP----LMSSSNASRRKGRVLKLDTL---------------LQLRSEAMTSPEQL 609

  Fly   311 RKRLSRSKNKVRRPRGYVVIDAPVTDSS--------------EDEDELDDEFKVSDV-AGTTSAD 360
            :                 |...|:..:|              ......|:..:.:.| ...|||.
  Fly   610 K-----------------VPSTPMPTASSPIAGRKPMPEEHCSGTSSADESMETAHVPQANTSAS 657

  Fly   361 SDSADSDDSEKEKKKPGPRGRPRKKPLKRGTDS--DGEPSSAQKKKYQPSSTASVGPFECPNCDL 423
            |.::.|.:|.....  ...|.........||.|  ...||..      |::..::  :||..||:
  Fly   658 STASSSGNSSNASS--NSNGNSSSNSSSNGTTSAVAAPPSGT------PAAAGAI--YECKYCDI 712

  Fly   424 TFSRKQSYVLHRKTHERIE-HACPICGKKFKVEWAYKTHMQRHEQERAH 471
            .|.....|.:|...|...: ..|.:||:|.........||.|:    ||
  Fly   713 FFKDAVLYTIHMGYHSCDDVFKCNMCGEKCDGPVGLFVHMARN----AH 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 16/77 (21%)
zf-C2H2 416..438 CDD:278523 7/21 (33%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368
C2H2 Zn finger 504..521 CDD:275368
hbNP_731267.1 C2H2 Zn finger 242..262 CDD:275368
C2H2 Zn finger 271..291 CDD:275368
zf-H2C2_2 283..308 CDD:290200
C2H2 Zn finger 299..319 CDD:275368
C2H2 Zn finger 327..345 CDD:275368
C2H2 Zn finger 707..727 CDD:275371 6/19 (32%)
C2H2 Zn finger 735..757 CDD:275371 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.