DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12391 and CG14655

DIOPT Version :9

Sequence 1:	NP_610639.1	Gene:	CG12391 / 36170	FlyBaseID:	FBgn0033581	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_649494.1	Gene:	CG14655 / 40594	FlyBaseID:	FBgn0037275	Length:	525	Species:	Drosophila melanogaster

Alignment Length:	120	Identity:	41/120 - (34%)
Similarity:	58/120 - (48%)	Gaps:	7/120 - (5%)

- Green bases have known domain annotations that are detailed below.

  Fly   403 KKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTHERIE-HACPICGKKFKVEWAYKTHMQRHE 466
            ||::...|..: |:.|..|..||:.:|||..|...|..:: |.|.:||:.||.......|.:.|.
  Fly   282 KKHKRLHTGEM-PYTCEICARTFTFQQSYHKHLLYHSEVKPHVCGVCGRAFKELSTLHNHQRIHS 345

  Fly   467 QERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTF--LTQQRLQR 519
            .|:. |:||:|.|.||.|.....|  .|.......|:|:.||:||  ...||..|
  Fly   346 GEKP-FKCEVCGKCFRQRVSFLVH--TRIHTGVMPYKCELCQKTFRYKVSQRTHR 397

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12391	NP_610639.1	zf-AD	240..313	CDD:285071
		zf-C2H2	416..438	CDD:278523	8/21 (38%)
		C2H2 Zn finger	418..438	CDD:275368	8/19 (42%)
		zf-C2H2	443..465	CDD:278523	7/21 (33%)
		C2H2 Zn finger	445..465	CDD:275368	6/19 (32%)
		C2H2 Zn finger	474..491	CDD:275368	7/16 (44%)
		C2H2 Zn finger	504..521	CDD:275368	8/18 (44%)
CG14655	NP_649494.1	C2H2 Zn finger	268..288	CDD:275368	2/5 (40%)
		zf-H2C2_2	281..304	CDD:290200	7/22 (32%)
		C2H2 Zn finger	324..344	CDD:275368	6/19 (32%)
		zf-H2C2_2	339..361	CDD:290200	9/22 (41%)
		C2H2 Zn finger	352..372	CDD:275368	9/21 (43%)
		zf-H2C2_2	364..389	CDD:290200	8/26 (31%)
		C2H2 Zn finger	380..396	CDD:275368	7/15 (47%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24390
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100