DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and znf131

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_956799.2 Gene:znf131 / 393477 ZFINID:ZDB-GENE-040426-1563 Length:558 Species:Danio rerio


Alignment Length:271 Identity:68/271 - (25%)
Similarity:101/271 - (37%) Gaps:54/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 AIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSS--EDEDELDDE---------FK 349
            |:..|:...|:.|..:.:  ..|.|:......:....|..|:.  |.|.|:.:|         .:
Zfish   120 ALNNRRNGTTSPQPGKSK--AKKRKISETSNVITESLPSADTEAVEIEVEVGEEHIEVEESGLVE 182

  Fly   350 VSDVA-GTTSADSDSAD----SDDSEKEKKKPGPRGRPRKKPLKRGTDS---DGEPSSAQKK--- 403
            |.||| |||...||.:.    :|.:.|.:     :|......:|:..::   ..|...|.|.   
Zfish   183 VVDVARGTTVPSSDDSALALLADITSKYQ-----QGEQTLHVIKKVDETVVVQEEAVVASKTLEN 242

  Fly   404 ----KYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTH----ERIEHACPICGKKFKVEWAYKT 460
                :.|.|...::  |.|..||..|........|.|||    || ...|..|||.:..|.|.|.
Zfish   243 IEVVEVQISQLDNL--FRCDKCDRCFKLYYHLKQHMKTHIASPER-GFVCRHCGKAYAREGALKQ 304

  Fly   461 HM----------QRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQ 515
            |:          .|.::::.|. ||.|.|.|......|.|:.:...|..|  ||..|...|....
Zfish   305 HLNNYHFDAEEQSRRQKKKVHV-CEYCEKQFDHFGHFKEHLRKHTGEKPF--ECPECHERFARNS 366

  Fly   516 RLQRHQAVGCQ 526
            .|:.|.: .||
Zfish   367 TLKCHMS-ACQ 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 4/16 (25%)
zf-C2H2 416..438 CDD:278523 7/21 (33%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 8/31 (26%)
C2H2 Zn finger 445..465 CDD:275368 8/29 (28%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 4/16 (25%)
znf131NP_956799.2 BTB 24..120 CDD:306997 68/271 (25%)
zf-C2H2 257..279 CDD:306579 7/21 (33%)
C2H2 Zn finger 259..279 CDD:275368 6/19 (32%)
C2H2 Zn finger 289..347 CDD:275368 17/58 (29%)
COG5048 <310..441 CDD:227381 19/71 (27%)
C2H2 Zn finger 327..344 CDD:275368 6/16 (38%)
zf-H2C2_2 339..364 CDD:316026 8/26 (31%)
C2H2 Zn finger 355..372 CDD:275368 4/16 (25%)
C2H2 Zn finger 419..439 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592560
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.