DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and CG10147

DIOPT Version :10

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_648046.1 Gene:CG10147 / 38733 FlyBaseID:FBgn0035702 Length:448 Species:Drosophila melanogaster


Alignment Length:341 Identity:83/341 - (24%)
Similarity:137/341 - (40%) Gaps:51/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   239 DQCRVCTS----KEELVCLFKKQIDATPADMLLVICPNVSILP--KDFMPQFICTKCMGSLTIAI 297
            |:||||:|    .:|...|......|.....    |.|:.:.|  :|.:|..||::|...|....
  Fly     5 DKCRVCSSDVARDDEAYNLLHHPYLAVKFSE----CTNLVVDPDDQDILPSEICSECYELLEKFH 65

  Fly   298 QLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSED-EDELDDEFKVSDVAGTTSADS 361
            ..|......|.:.|.:...:..|:.|.:       ||.:..|| |:||:.|..:.:.......|:
  Fly    66 SFRALCIIADNKWRSKSLVTWKKIDRRK-------PVYEVDEDEEEELELEELLLEPPEMIICDT 123

  Fly   362 D-SADSDDSEKEKKKPGPRGRPRKKPLKRGTDSDGEPSSAQKKKYQ--PSSTASVGPFECPNCDL 423
            : ||.:.....|:..|       .......|::..:|...:||..:  |.:|     ::|..|..
  Fly   124 NLSAQNTPIVAEQAPP-------TLVFHTFTENVQQPPETEKKALEEPPLTT-----YKCDLCAD 176

  Fly   424 TFSRKQSYVLHRKTHE-RIEHAC--PICGKKFKVEWAYKTHMQRHEQERAHFRCEL--CPKIFRL 483
            .|..::..:||:|.|: .:.:.|  |.|.:.|......:.|...|.:....|.||.  |.:::|.
  Fly   177 EFREEKRLILHKKEHQGHMLYHCTEPGCEEAFNRFENLRQHELEHSEVGMRFVCEEEGCNRMYRH 241

  Fly   484 RAELKHHMAQRHD------EHGFIYECKRCQRTFLTQQRLQRHQAV-GCQRHKEDSVRIKEEQSR 541
            :|.||:|.::.||      .|    .|:.|.|.|.|...|.:|:.. |.|.....:..:.|...|
  Fly   242 KASLKYHQSKAHDIGKPLKTH----MCEFCGRVFKTGSALSQHRFTHGDQLVLPYACELPECSMR 302

  Fly   542 FKQESRSKDD--RHHG 555
            |....:.|..  ||.|
  Fly   303 FYSTEKLKIHMMRHQG 318

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity