DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp174

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001074686.1 Gene:Zfp174 / 385674 MGIID:2686600 Length:407 Species:Mus musculus


Alignment Length:403 Identity:86/403 - (21%)
Similarity:129/403 - (32%) Gaps:149/403 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 KEELVCL-------------FKKQI-DATPADMLLVICP----------------NVSILPKDF- 280
            :|.|.||             .|:|| :....:..|||.|                .:..|.:|. 
Mouse    61 QEALSCLQQLCRQWLQPELHTKEQILELLVMEQFLVILPPEIQAQVWHRYPKSSREIVTLVEDLH 125

  Fly   281 ----MPQFICTKCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSE-D 340
                .|:...|.||....:.:: :...:..:||||.                  ..|.|.|.: .
Mouse   126 RTSKKPKQWVTVCMQGQKVLLE-KTGAQLVEQELRD------------------FQPQTPSRDIQ 171

  Fly   341 EDELDD---------------EFKV--SDVAGTTSADSDSADSD-DSEKEKKKPGPR------GR 381
            ||.|::               |..|  ..|...|..:|.....| ::.|:::..|.:      ||
Mouse   172 EDSLEEPSCEGSHEQLSPHHWEKTVLQEPVLRLTETESSRMRGDKENPKQEEARGAKACTVLHGR 236

  Fly   382 PRKKPLKRGTDSDGEP-----SSAQKKKYQ---PSSTASVGPFE--C-------------PNCDL 423
            |     |.||....||     |.|:..::|   |.|..|:..::  |             |..:|
Mouse   237 P-----KGGTLHSPEPRGVTASDARLLQWQVRPPQSPKSLAHYQKHCRELEYISNPLRGHPLREL 296

  Fly   424 TFS-----RKQSYVL----HRKTH-ERIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCP 478
            ..|     |..|.:|    |:..| .:..::|..|||.|......|.|.:.|..||.:. |..|.
Mouse   297 KRSRGGRRRSLSGLLQCLGHQAAHPAKKPYSCEDCGKNFTWNSELKRHRRVHTGERPYI-CGECG 360

  Fly   479 KIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQSRFK 543
            ..|..::.||.|  ||.......|:|..|.:.|.....|.:|..:                    
Mouse   361 NCFGRQSTLKLH--QRIHTGEKPYQCSHCGKCFRQSSNLHQHHRL-------------------- 403

  Fly   544 QESRSKDDRHHGN 556
                     ||||
Mouse   404 ---------HHGN 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 21/100 (21%)
zf-C2H2 416..438 CDD:278523 8/45 (18%)
C2H2 Zn finger 418..438 CDD:275368 8/41 (20%)
zf-C2H2 443..465 CDD:278523 7/21 (33%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 4/16 (25%)
Zfp174NP_001074686.1 SCAN 42..152 CDD:128708 17/91 (19%)
SCAN 42..130 CDD:280241 13/68 (19%)
C2H2 Zn finger 328..348 CDD:275368 7/19 (37%)
zf-H2C2_2 340..365 CDD:290200 8/25 (32%)
COG5048 352..>407 CDD:227381 17/86 (20%)
C2H2 Zn finger 356..376 CDD:275368 8/21 (38%)
zf-H2C2_2 369..393 CDD:290200 9/25 (36%)
C2H2 Zn finger 384..404 CDD:275368 5/48 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.