DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Kr

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:210 Identity:51/210 - (24%)
Similarity:82/210 - (39%) Gaps:57/210 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 PFECPNCDLTFSRKQSYVLHRKTHERIE-----HACPICGKKFKVEWAYKTHMQRHEQERAHFRC 474
            |||||.|...|:|..    |.|||.|:.     :.|..|.::|......:.|::.|..||. :.|
  Fly   249 PFECPECHKRFTRDH----HLKTHMRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERP-YTC 308

  Fly   475 ELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKE--------- 530
            |:|...|....:||.||...:.|..|  ||:||...|..:..|..|:. |.|....         
  Fly   309 EICDGKFSDSNQLKSHMLVHNGEKPF--ECERCHMKFRRRHHLMNHKC-GIQSPPTPALSPAMSG 370

  Fly   531 ------DSVRIKEEQSRF---------------KQESRSKDD-------------RHHGNNSSKR 561
                  .::.|:...:||               .:::..:||             ..|.:|.::|
  Fly   371 DYPVAISAIAIEASTNRFAAMCATYGGSNESVDMEKATPEDDGPLDLSEDGASSVDGHCSNIARR 435

  Fly   562 RPGEGRDLFKAVAPP 576
            :..:.|.:|: :.||
  Fly   436 KAQDIRRVFR-LPPP 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 9/21 (43%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-C2H2 443..465 CDD:278523 4/21 (19%)
C2H2 Zn finger 445..465 CDD:275368 4/19 (21%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368
zf-H2C2_2 237..261 CDD:290200 7/11 (64%)
C2H2 Zn finger 252..272 CDD:275368 10/23 (43%)
zf-H2C2_2 264..289 CDD:290200 8/24 (33%)
C2H2 Zn finger 280..300 CDD:275368 4/19 (21%)
zf-H2C2_2 292..316 CDD:290200 7/24 (29%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 11/25 (44%)
C2H2 Zn finger 336..352 CDD:275368 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.