DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Ovol3

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001276749.1 Gene:Ovol3 / 365226 RGDID:1583800 Length:190 Species:Rattus norvegicus


Alignment Length:143 Identity:38/143 - (26%)
Similarity:57/143 - (39%) Gaps:18/143 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   398 SSAQKKKYQPSSTASV-------GPFECPNCDLTFSRKQSYVLHRKTHERI-EHACPICGKKFKV 454
            ||..:..:..||..::       |...||.|...|..::....|.|.|... .|.|..|||.|..
  Rat    44 SSGLRDTWAASSQGTLTSVPKGPGTLSCPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHD 108

  Fly   455 EWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRH---------DEHGFIYECKRCQRT 510
            .:..|.||:.|...|. |||..|.|.|..|..|:.|:|:.|         :....::.|:.|..|
  Rat   109 AFDLKRHMRTHTGIRP-FRCGACGKAFTQRCSLEAHLAKVHGQPASYAYRERREKLHVCEDCGFT 172

  Fly   511 FLTQQRLQRHQAV 523
            ....:...:|:.:
  Rat   173 SSRPEAYAQHRTL 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 6/21 (29%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 9/21 (43%)
C2H2 Zn finger 445..465 CDD:275368 8/19 (42%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 3/16 (19%)
Ovol3NP_001276749.1 COG5048 <19..>127 CDD:227381 24/83 (29%)
C2H2 Zn finger 71..91 CDD:275368 6/19 (32%)
zf-C2H2 97..119 CDD:278523 9/21 (43%)
C2H2 Zn finger 99..119 CDD:275368 8/19 (42%)
zf-H2C2_2 111..136 CDD:290200 11/25 (44%)
C2H2 Zn finger 127..148 CDD:275368 8/20 (40%)
C2H2 Zn finger 166..186 CDD:275368 4/20 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.