DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Kr-h1

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:425 Identity:102/425 - (24%)
Similarity:145/425 - (34%) Gaps:133/425 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 ELITGDEPGDLADVPIRERKKEEPVDEDQCRVCTSKEELVCLFKKQIDATPADMLLVICPNVSIL 276
            |.||...|   ...|..:|.|.|||.                   ...|:.|.:..|..|:.|  
  Fly   150 ESITNAAP---TAAPSAQRIKTEPVG-------------------GFPASAAVVSQVRKPSAS-- 190

  Fly   277 PKDFMPQFICTKC---MGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGY--VVIDAPVTD 336
                .|||.|.:|   .||        |...|:..:     |.|||:.....|.  ..:.|||:.
  Fly   191 ----KPQFKCDQCGMTFGS--------KSAHTSHTK-----SHSKNQDLSLNGASGAGVAAPVST 238

  Fly   337 SSEDEDELDDEFKVSDVAGTTSADSDSADSDDSEKEKKKPGPRGRPRK---KPLKR---GTDSDG 395
            ::   .||:|       ||.                     |.|.|:.   |||..   |.| ..
  Fly   239 AA---IELND-------AGL---------------------PVGIPKSPTIKPLANVAAGAD-PY 271

  Fly   396 EPSSAQKKKYQPS-------STASVGPFECPNCDLTFSRKQSYVLHRKTH--ERIEHACPICGKK 451
            :.:..||....|:       :.....||||..|...||.|::..:||:.|  || .:.|.:||:.
  Fly   272 QCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKER-PYKCDVCGRA 335

  Fly   452 FKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDE-----------HGFI---- 501
            |:.......||:.|..||.| :|.:|.|.|....:|..||.....|           .||.    
  Fly   336 FEHSGKLHRHMRIHTGERPH-KCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPEPGCGKGFTCSKQ 399

  Fly   502 -------------YECKRCQRTFLTQQ--RLQRHQAVGCQRHKEDSVRIKEEQSRFKQESRSKDD 551
                         |.|..|.|.|....  :|.|.|..|.:.:|   ..|.:|..:.|:|..:   
  Fly   400 LKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYK---CTICDETFKNKKEMEA--- 458

  Fly   552 RHHGNNSSKRRPGEGRDLFKAVAPPTTTYWSDSFS 586
              |....:...|.:..:...|.|..:|:..|.:.|
  Fly   459 --HIKGHANEVPDDEAEAAAASAAASTSAGSSAGS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 14/75 (19%)
zf-C2H2 416..438 CDD:278523 9/21 (43%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 6/18 (33%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 6/32 (19%)
COG5048 <270..420 CDD:227381 39/151 (26%)
zf-C2H2 271..293 CDD:278523 3/21 (14%)
C2H2 Zn finger 273..293 CDD:275368 3/19 (16%)
zf-H2C2_2 286..309 CDD:290200 5/22 (23%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 313..338 CDD:290200 9/25 (36%)
C2H2 Zn finger 329..349 CDD:275368 6/19 (32%)
zf-H2C2_2 344..366 CDD:290200 10/22 (45%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
zf-H2C2_2 370..396 CDD:290200 6/25 (24%)
C2H2 Zn finger 385..407 CDD:275368 2/21 (10%)
zf-H2C2_2 400..424 CDD:290200 5/23 (22%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523 6/29 (21%)
C2H2 Zn finger 443..463 CDD:275368 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.