DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and CG11695

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:459 Identity:98/459 - (21%)
Similarity:156/459 - (33%) Gaps:171/459 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 CRVCTSKEELVCLFKKQIDA----TPADMLLVICPNVS--ILPKDFMPQFICTKCMGSLT----- 294
            ||:|....|.......|.|:    .|:::..:|..::.  :||.|.:.:.:||:|...|.     
  Fly     3 CRLCLDDAEHSVPIFDQDDSGDQPVPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLADFEQF 67

  Fly   295 IAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDED-----------ELD--- 345
            .|:.::|||..  |:|:                      :...|||||           |:|   
  Fly    68 CAMVMKKQLGL--QQLK----------------------MEPFSEDEDADTKAQILCEPEIDVSP 108

  Fly   346 ---DEFKVSDVAGTTSADSDSAD-SDDSEKEKKKPGP-------------------RGRPRKKPL 387
               |..:.:::.|..|::|.|:. ...|.:|.:.|.|                   :.:.|.|..
  Fly   109 AAADNEECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTKTH 173

  Fly   388 KRGTDSD------GEPSS-AQKKKYQPSSTASVGPFEC---------PN---------------- 420
            |...|.|      |:|.| :...:...|..|..|..||         ||                
  Fly   174 KAEADEDEDAEGEGDPESRSSNSREMDSYIALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLG 238

  Fly   421 ----CDLTFSRKQSYVLHRKTH----------------ERIEH----------------ACPICG 449
                |...:.::..||.|...|                .||.:                ||..|.
  Fly   239 YVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKDDLSFACDQCS 303

  Fly   450 KKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQ 514
            |:|..::....|.:.|:||| :.:|:.|.:.||...:|:.||.:.||.....:.|..|...|.|:
  Fly   304 KRFSKQFLLTIHSRVHQQER-NEQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTK 367

  Fly   515 QRLQRHQ-----------AVGCQR-----HKEDSVR--------------IKEEQSRFKQESRSK 549
            |.|..|:           .|.||.     ..|:|:|              .|.||...::.||:|
  Fly   368 QNLLVHKRTVHREGSQLPEVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAK 432

  Fly   550 DDRH 553
            ...|
  Fly   433 LAAH 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 21/82 (26%)
zf-C2H2 416..438 CDD:278523 8/50 (16%)
C2H2 Zn finger 418..438 CDD:275368 7/48 (15%)
zf-C2H2 443..465 CDD:278523 6/37 (16%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 6/16 (38%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 20/79 (25%)
C2H2 Zn finger 268..289 CDD:275368 2/20 (10%)
C2H2 Zn finger 299..319 CDD:275368 5/19 (26%)
C2H2 Zn finger 327..348 CDD:275368 7/20 (35%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 6/17 (35%)
C2H2 Zn finger 448..468 CDD:275368
C2H2 Zn finger 476..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.