DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and CG11696

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:657 Identity:141/657 - (21%)
Similarity:228/657 - (34%) Gaps:205/657 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TPLAETNGEQRQNPQESAQNQEQP-QPRQDLAGKSVGSADDGVSGTVGQIMDYL-----EDDAGA 64
            |.|.|........|.....|.|.| :|:....|      ||        |.|::     .|...|
  Fly    86 TELPELPELTEPEPALVVWNTESPIEPKLSYEG------DD--------IKDHILCEPVIDALSA 136

  Fly    65 TADQDAEMGEAEYLDGE-MPQEDESETPQTEKANEGCQESSNKKDLQES--AAKDDFSKEKSGED 126
            ..::|::.|:....|.| ..|.||.|.|:.:......:....|..||::  ..|..:.|.|. ::
  Fly   137 GDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTALQQTHQIIKRKYEKRKQ-QN 200

  Fly   127 GEKDTDKEKKATHLHEDNNDDAEKDGDEADAEDEDDVEKPEDEDGTEEGDEAIEEDEDALDEDED 191
            ..|.|:     ..|.|......|.....|.|||        |:||.|:     ||||:.:..:..
  Fly   201 KAKITE-----LSLRESRARQRELKRSSAGAED--------DQDGDED-----EEDEEDVGGELT 247

  Fly   192 PNEEVEEIEPDFETGTDAEGELITGDEPGDLADVPIRERKKEEPVD------EDQCRVCTSKEEL 250
            |:.: |:.:|..:.|.....:|:|.|:..|.::||::....:|..|      :..|.:|      
  Fly   248 PDAD-EQPKPRGKRGRPKTKKLVTADDNDDTSEVPVKRSSIKEMDDYIAANVKLDCAIC------ 305

  Fly   251 VCLFKKQIDATPADMLLVICPNVSILPKDFMPQFICT---KCMGSLTIAIQLRKQLETTD----- 307
                     |.|.:       :.:.|.:.|..:..||   ||..:     :.:|:....|     
  Fly   306 ---------AAPLE-------DFNDLKRHFRVEHDCTGYVKCCNN-----RYKKRTLYVDHLHCH 349

  Fly   308 --------QELRKR-LSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDS 363
                    |..||. |:|:...:...|.:           ..:.||..:..:.:           
  Fly   350 KDPQYFSCQSCRKNFLNRNSQVMHMLRFH-----------SQQQELVHQCAICE----------- 392

  Fly   364 ADSDDSEKEKKKPGPRGRPRKKPL-------KRGTDSDGEP------SSAQKKKYQPSS------ 409
                            .|..||.|       .:||:   .|      |...:.|::.|:      
  Fly   393 ----------------ARFAKKFLLTMHLKGHKGTE---RPEVCDTCSKTFRTKFELSAHVKRMH 438

  Fly   410 TASVGPFECPNCDLTFSRKQSYVLHRKT-HER---IEHACPICGKKFKVEWAYKTHMQRHEQE-- 468
            .|...|..|..|...|..|.::::|:|. |..   .|..|.:||:..:.|.:.:.|:.||:..  
  Fly   439 AADFTPIICDICGTHFRSKANFLIHKKALHPDGPVAEVQCTLCGRWLRDERSLRKHLARHDDRDG 503

  Fly   469 RAHFRCELCPKIFRLRAELK-----HHMAQRHD---------------EH-----GF-IYECKRC 507
            ...:||.||......||.|.     ||.|:||.               ||     |. :|:|:.|
  Fly   504 DTKYRCLLCNAEKSSRAALSSHMRYHHSAKRHKCSLCDKEFKLPRALAEHMATHTGIDLYQCQFC 568

  Fly   508 QRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQSRFKQESRSKDDR----HHGNNSSKRRPGEGRD 568
            .|||.:...:..|:.   :.|..|.||      ::.|.|.|....    .|.|:.::..|     
  Fly   569 TRTFKSHANMHNHKK---KMHPNDWVR------KYSQPSSSITSTAAPLAHPNHPNQPAP----- 619

  Fly   569 LFKAVAP 575
              .|.||
  Fly   620 --PAAAP 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 14/88 (16%)
zf-C2H2 416..438 CDD:278523 6/22 (27%)
C2H2 Zn finger 418..438 CDD:275368 6/20 (30%)
zf-C2H2 443..465 CDD:278523 5/21 (24%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 474..491 CDD:275368 7/21 (33%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 2/21 (10%)
C2H2 Zn finger 357..378 CDD:275368 6/20 (30%)
C2H2 Zn finger 388..408 CDD:275368 4/46 (9%)
C2H2 Zn finger 417..438 CDD:275368 3/20 (15%)
C2H2 Zn finger 447..465 CDD:275368 5/17 (29%)
C2H2 Zn finger 478..498 CDD:275368 5/19 (26%)
C2H2 Zn finger 509..529 CDD:275368 6/19 (32%)
C2H2 Zn finger 537..557 CDD:275368 2/19 (11%)
C2H2 Zn finger 565..583 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.