DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and CG18262

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster


Alignment Length:507 Identity:99/507 - (19%)
Similarity:164/507 - (32%) Gaps:175/507 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SKEKSGEDGEKDTDKEKKATHLHEDNNDDAEKDGDEADAEDEDDVEKPEDEDGTEEGDEAIEEDE 183
            |.|...:...:|..:.:....|||:...:|..|.:|.:.|.|:..::...:......:..:|..|
  Fly    64 SNELESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETRE 128

  Fly   184 DALDEDEDPNEEVEEIEPDFETGTDAEGELITGDEPGDLADVPIRERKKEEPVDEDQCRVCTSKE 248
            |.||           ||.|:..|..:|......:|.|:..|        ::..|.:..:      
  Fly   129 DLLD-----------IELDWTGGEQSEHNETHEEEEGESDD--------DDTKDSNDTK------ 168

  Fly   249 ELVCLFKKQIDATPADMLLVICPNVSILPKDFMPQFICTKCMGSLTIAIQLRKQLETTDQELRKR 313
                           |||                 |.|.:|    ..|...::.|::     .:|
  Fly   169 ---------------DML-----------------FQCDQC----DRAYNTKRSLQS-----HRR 192

  Fly   314 LSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDSADSDDSEKEKKKPGP 378
            |..|:                                        |:..|.|...||:..||   
  Fly   193 LKHSE----------------------------------------ANGGSLDKSASERNSKK--- 214

  Fly   379 RGRPRKKPLK-------------------RG---------TDSDGEP--SSAQKKKYQPSSTASV 413
                ||.|.|                   ||         .|..|:|  .|....::: ...:.:
  Fly   215 ----RKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTGIFCDICGKPFTQSGNMMRHR-QRHSGI 274

  Fly   414 GPFECPNCDLTFSRKQSYVLHRKTHE-RIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELC 477
            .|.:||.||.||..::....|...|. |:...|.:||:..:.......||:||..||. .:||:|
  Fly   275 KPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERP-AKCEVC 338

  Fly   478 PKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQSRF 542
            .|.|....:|..|.....:...|:  |..|..||..::.|:.|:.            :..||.::
  Fly   339 GKAFYSFHDLNVHAVSHTNLRPFV--CDVCGSTFQRKKALRVHKL------------LHSEQRKY 389

  Fly   543 KQESRSKD-------DRHHGNNSSKRRPGEGRDLFKAV--------APPTTT 579
            ..:...|.       :.|..::...|..|..:.|.::|        :|||||
  Fly   390 ACKLCGKTFAQSGGLNAHMRSHDPARVKGAVKPLPQSVTIEVIEGKSPPTTT 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 8/72 (11%)
zf-C2H2 416..438 CDD:278523 7/21 (33%)
C2H2 Zn finger 418..438 CDD:275368 7/19 (37%)
zf-C2H2 443..465 CDD:278523 5/21 (24%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 474..491 CDD:275368 6/16 (38%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 2/21 (10%)
C2H2 Zn finger 251..271 CDD:275368 4/20 (20%)
COG5048 <256..415 CDD:227381 39/174 (22%)
zf-H2C2_2 263..288 CDD:290200 7/25 (28%)
C2H2 Zn finger 279..327 CDD:275368 14/47 (30%)
zf-H2C2_2 320..342 CDD:290200 10/22 (45%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 6/31 (19%)
zf-C2H2 389..411 CDD:278523 2/21 (10%)
C2H2 Zn finger 391..411 CDD:275368 2/19 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.