DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp438

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_017456046.1 Gene:Zfp438 / 307024 RGDID:1307214 Length:800 Species:Rattus norvegicus


Alignment Length:467 Identity:89/467 - (19%)
Similarity:143/467 - (30%) Gaps:153/467 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 TGTDAEGEL--ITGDEPGDLAD--VPIRERKKEEPVD-------------EDQCRVCTSKEELVC 252
            |....:|:|  :..|..|||..  :|....:...|..             |...:...:.|||  
  Rat   193 TSAIGQGDLSPLETDSCGDLEPPAIPAYSTENSSPQSLPASMQKAGCARKETPTKPAVASEEL-- 255

  Fly   253 LFKKQIDATPA-DMLLVICPNVSILPKDFMPQFICTKCMGSLTIAIQLRKQLETTDQELRKRLSR 316
                |....|| .::.....:||::.||.:|  |........|..:::....|..:.......:.
  Rat   256 ----QEQVAPAHSVVSSTVQSVSVVTKDKLP--ILPSSRVKTTEVVKVEPDAENAESSSSGCRAN 314

  Fly   317 SKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDSADS------------DDS 369
            .:.::....|:   ||                 .:::|..|.|...|..|            |.:
  Rat   315 CEERLSITEGF---DA-----------------ATEIANKTPALHGSKQSACKSAFCPVTKLDLN 359

  Fly   370 EKEKKKPG--PRGRPRKKP---------------------LKRGTDSDGEPSS----AQKKKYQ- 406
            .|.|...|  .|||..|.|                     ::|..::..||..    |..:||: 
  Rat   360 RKAKPSSGVKRRGRKWKVPDDILALQGKRRRCIIGMCGDSIERARNNPPEPRDQKPRATSRKYRS 424

  Fly   407 -----------------PSSTASVGPFEC----------PNCDLTFSRKQSYVLHRKTHERIE-- 442
                             |::..|..|...          |.|   .|.|||..|..|....:.  
  Rat   425 IMPKPVIVLSALAPLASPAAMLSQAPSGLGQDVLNNALPPKC---LSSKQSDNLAPKPSSALRNG 486

  Fly   443 --------HACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEH- 498
                    |.||:|...|:.:.....||..|...|. :.|.:|.|.:.....|..||...|.:: 
  Rat   487 FSGIKKPWHMCPVCNYHFQFKHHLLDHMNTHTNRRP-YSCGICRKTYVRPGSLSAHMKLHHGDNR 550

  Fly   499 -GFIYECKRCQRTFLTQQRLQRHQAVGCQR----HKEDSVRI--------KEEQSRFKQESRSKD 550
             ..:..|:.|.:.|            |..|    |.::..|:        .|.||....:::.:|
  Rat   551 PKKLVCCEFCAKVF------------GHVRVYFGHLKEVHRVVISTEPTPSELQSEDTPKNKDRD 603

  Fly   551 DRHHGNNSSKRR 562
            ....|.:||..|
  Rat   604 PSMQGPDSSLER 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 14/73 (19%)
zf-C2H2 416..438 CDD:278523 8/31 (26%)
C2H2 Zn finger 418..438 CDD:275368 8/29 (28%)
zf-C2H2 443..465 CDD:278523 7/21 (33%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 4/16 (25%)
C2H2 Zn finger 504..521 CDD:275368 3/16 (19%)
Zfp438XP_017456046.1 C2H2 Zn finger 497..517 CDD:275368 6/19 (32%)
zf-H2C2_2 509..534 CDD:290200 7/25 (28%)
C2H2 Zn finger 525..545 CDD:275368 6/19 (32%)
C2H2 Zn finger 557..575 CDD:275368 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.