DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp711

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001368827.1 Gene:Zfp711 / 245595 MGIID:3045342 Length:805 Species:Mus musculus


Alignment Length:709 Identity:145/709 - (20%)
Similarity:225/709 - (31%) Gaps:269/709 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEADIT---PLAETNGEQRQNPQESAQNQEQPQPRQDLAGKSVGSADDGVSGTVGQIMDYLEDDA 62
            :|||:.   .|.|.:|:.....:...:....|:        .|..| |.|||..|. ::::..|.
Mouse    94 LEADVAIEEDLEEDDGDHILTSELITETVRVPE--------QVFVA-DLVSGPDGH-LEHVVQDC 148

  Fly    63 GATADQDAEMGEAEYLDGEMPQEDESETPQTEKANEGCQESSNKKDLQESAAKDDFSKEKSGED- 126
            .:..|....:.|...:       ..|:|....:|..|...|:.....:|.   ||...:.:.|| 
Mouse   149 VSGVDSPTMVSEEVLV-------TNSDTETVIQAGGGVPGSTVTIKTEED---DDDDVKSTSEDY 203

  Fly   127 --------GEK-----DTDKEKKATHLHEDNNDDAEKDGDEA------DAEDEDDVEKPEDEDGT 172
                    |||     :|..:..:....||..:||  .|.|.      .||.|||||....|..|
Mouse   204 LMISLDDVGEKLEHMGNTPLKIASDGSQEDVKEDA--FGSEVIKVYIFKAEAEDDVEIGGTEIVT 266

  Fly   173 EEGDEAIEEDEDALDED------------EDPNEEVEEIEPDFETGTDAEGEL----ITGDEPGD 221
            |....:.......||:.            :|.::|.::|     :..|...||    |.|:|.|.
Mouse   267 ESEYSSGHSVAGVLDQSRMQREKMVYMAVKDSSQEQDDI-----SNADISNELCMEVIIGEEEGT 326

  Fly   222 LADVPIRE---RKKEEPV----DEDQCRVCTSKEELVC-----LFKKQID--ATPADMLLVICPN 272
            ..::|:::   .|...||    ..|:.||....||  |     .|...::  .|.|...|.||.:
Mouse   327 PLEIPLQDCDVNKTGSPVLSPASYDERRVSRRYEE--CQAPGNTFDSALENRNTTAAQYLQICDS 389

  Fly   273 VSILPKDFMPQFICTKCMGSLTIAIQLRKQLETTDQELRKRL-SRSKNKVRRPRGYVVIDAPVTD 336
            ::                               |::.|:::: .|.:.:.|:.:..|:|      
Mouse   390 MN-------------------------------TNKVLKQKIKKRRRGETRQWQTAVII------ 417

  Fly   337 SSEDEDELDDEFKVSDVAGTTSADSDSADSDDSEKEKKKPGPRGRP---------RKKPLKRG-- 390
                                                    ||.|:|         .||...||  
Mouse   418 ----------------------------------------GPDGQPLTVYPCHICTKKFKSRGFL 442

  Fly   391 -TDSDGEPSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLH----------RKTHERIE-- 442
             ......|....:||||           |.:||.|.::|.|:..|          .||||..|  
Mouse   443 KRHMKNHPDHLMRKKYQ-----------CTDCDFTTNKKVSFHNHLESHKLINKVDKTHEFTEYT 496

  Fly   443 ----------------------------------------------------HACPICGKKFKVE 455
                                                                |.|..|||.|:..
Mouse   497 RRYREASPLSSNKLILRDKEPKMHKCKYCDYETAEQGLLNRHLLAVHSKSFPHVCVECGKGFRHP 561

  Fly   456 WAYKTHMQRHEQERAHFRCELCPKIFRL--RAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQ 518
            ...|.||:.|..|:. ::|:.|  .||.  ::.||.|:..:|..: ..|:|:.|.:.|..::.||
Mouse   562 SELKKHMRTHTGEKP-YQCQYC--AFRCADQSNLKTHIKSKHGSN-LPYKCEHCPQAFGDERELQ 622

  Fly   519 R----------HQAVGCQRHKEDSVRIKEEQSRFKQESRSKDDRHHGNNSSK--RRPGE 565
            |          ||...|.....:|..:|    |......:||..|......|  .||.|
Mouse   623 RHLDLFQGHKTHQCPHCDHKSTNSSDLK----RHIISVHTKDFPHKCEVCDKGFHRPSE 677

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 13/79 (16%)
zf-C2H2 416..438 CDD:278523 8/31 (26%)
C2H2 Zn finger 418..438 CDD:275368 8/29 (28%)
zf-C2H2 443..465 CDD:278523 9/21 (43%)
C2H2 Zn finger 445..465 CDD:275368 8/19 (42%)
C2H2 Zn finger 474..491 CDD:275368 6/18 (33%)
C2H2 Zn finger 504..521 CDD:275368 6/26 (23%)
Zfp711NP_001368827.1 Zfx_Zfy_act 65..412 CDD:398398 79/377 (21%)
COG5048 425..805 CDD:227381 60/272 (22%)
C2H2 Zn finger 429..449 CDD:275368 4/19 (21%)
C2H2 Zn finger 522..543 CDD:275368 0/20 (0%)
C2H2 Zn finger 551..571 CDD:275368 8/19 (42%)
C2H2 Zn finger 579..600 CDD:275368 7/22 (32%)
C2H2 Zn finger 608..634 CDD:275368 6/25 (24%)
C2H2 Zn finger 636..657 CDD:275368 4/24 (17%)
C2H2 Zn finger 665..685 CDD:275368 4/13 (31%)
C2H2 Zn finger 722..742 CDD:275368
C2H2 Zn finger 750..771 CDD:275368
C2H2 Zn finger 779..799 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.