| Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_780675.1 | Gene: | Zfp770 / 228491 | MGIID: | 2445100 | Length: | 705 | Species: | Mus musculus |
| Alignment Length: | 217 | Identity: | 45/217 - (20%) |
|---|---|---|---|
| Similarity: | 70/217 - (32%) | Gaps: | 58/217 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 415 PFECPNCDLTFSRKQSYVLHRKTHER-----------IE-------------------------- 442
Fly 443 ---------------HACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMA 492
Fly 493 QRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVRIK---EEQSRFKQESRSKDDRHH 554
Fly 555 GNNSSKRRPGEGRDLFKAVAPP 576 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12391 | NP_610639.1 | zf-AD | 240..313 | CDD:285071 | |
| zf-C2H2 | 416..438 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 5/19 (26%) | ||
| zf-C2H2 | 443..465 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 445..465 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 474..491 | CDD:275368 | 8/16 (50%) | ||
| C2H2 Zn finger | 504..521 | CDD:275368 | 6/16 (38%) | ||
| Zfp770 | NP_780675.1 | C2H2 Zn finger | 33..53 | CDD:275368 | |
| zf-H2C2_2 | 46..70 | CDD:404364 | |||
| C2H2 Zn finger | 61..81 | CDD:275368 | |||
| C2H2 Zn finger | 87..107 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 166..186 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 179..203 | CDD:404364 | 9/24 (38%) | ||
| C2H2 Zn finger | 194..214 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 222..242 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 487..507 | CDD:275368 | |||
| zf-H2C2_2 | 500..524 | CDD:404364 | |||
| C2H2 Zn finger | 515..535 | CDD:275368 | |||
| C2H2 Zn finger | 642..662 | CDD:275368 | |||
| zf-H2C2_2 | 655..679 | CDD:404364 | |||
| C2H2 Zn finger | 670..690 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167847288 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||