| Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_033564.2 | Gene: | Plagl1 / 22634 | MGIID: | 1100874 | Length: | 704 | Species: | Mus musculus |
| Alignment Length: | 220 | Identity: | 56/220 - (25%) |
|---|---|---|---|
| Similarity: | 93/220 - (42%) | Gaps: | 38/220 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 383 RKKPLKRGTDSDGEPSSAQKKKYQPSSTASVGPF-ECPNCDLTFSRKQSYVLHRKTHE--RIEHA 444
Fly 445 CPICGKKFKVEWAYKTHMQRHEQERAHFRCELCP----------KIFRLRAELKHHMAQRHDEHG 499
Fly 500 FIYECKRCQRTFLTQQRLQRHQAV--GCQRHKEDSVRIKEEQSRFKQESRSKDD---RHHGNNSS 559
Fly 560 KR------RPGEGRDLFKAVAPPTT 578 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12391 | NP_610639.1 | zf-AD | 240..313 | CDD:285071 | |
| zf-C2H2 | 416..438 | CDD:278523 | 7/22 (32%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 443..465 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 445..465 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 474..491 | CDD:275368 | 5/26 (19%) | ||
| C2H2 Zn finger | 504..521 | CDD:275368 | 6/16 (38%) | ||
| Plagl1 | NP_033564.2 | C2H2 Zn finger | 6..26 | CDD:275368 | |
| C2H2 Zn finger | 34..56 | CDD:275368 | 2/21 (10%) | ||
| zf-H2C2_2 | 49..73 | CDD:290200 | 6/23 (26%) | ||
| C2H2 Zn finger | 64..84 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 93..113 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 122..142 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 158..178 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 186..207 | CDD:275368 | 4/20 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167847334 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||