DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Y5F2A.4

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_502063.1 Gene:Y5F2A.4 / 178004 WormBaseID:WBGene00012385 Length:454 Species:Caenorhabditis elegans


Alignment Length:189 Identity:45/189 - (23%)
Similarity:72/189 - (38%) Gaps:55/189 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 PFECPNCDLTFSRKQSYVLHRKTHERI-EHACPICGKKFKVEWAYKTHMQRHEQERAHFR----- 473
            |.:|..||..|.|......|:.||..: .::|..|.:||    ..|:|:.|| ..|.|..     
 Worm    42 PLKCSMCDKVFPRLSHLQRHQMTHLNVRNYSCTFCEEKF----VQKSHLTRH-VSRKHSNAPGVE 101

  Fly   474 -----CELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTF-LTQQRLQRHQAVGCQRH---- 528
                 |:.|.::|:...|::.|....|:.|    :||:||... .....|::|. :.|:::    
 Worm   102 VDWTACDKCGQLFKTTYEMRIHRQTYHELH----KCKQCQEVIEAGSDGLRKHH-MQCRKYSNVC 161

  Fly   529 ---------------------KEDSVRIKEEQSRFKQESRSKDDRH------HGNNSSK 560
                                 |:.:...|...|.|:|  |.:.|||      |....||
 Worm   162 DECGASFSRPADLVSHETSCLKKFAFVCKPCDSYFRQ--RVQLDRHIKKAHFHPTKCSK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 6/21 (29%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 4/16 (25%)
C2H2 Zn finger 504..521 CDD:275368 5/17 (29%)
Y5F2A.4NP_502063.1 C2H2 Zn finger 6..27 CDD:275368
zf-C2H2 44..65 CDD:278523 6/20 (30%)
C2H2 Zn finger 45..65 CDD:275368 6/19 (32%)
C2H2 Zn finger 73..94 CDD:275368 9/25 (36%)
C2H2 Zn finger 107..126 CDD:275368 5/18 (28%)
C2H2 Zn finger 161..181 CDD:275368 0/19 (0%)
C2H2 Zn finger 189..212 CDD:275368 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.