DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and ztf-6

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_492877.1 Gene:ztf-6 / 173014 WormBaseID:WBGene00012317 Length:480 Species:Caenorhabditis elegans


Alignment Length:471 Identity:91/471 - (19%)
Similarity:152/471 - (32%) Gaps:137/471 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ANEGCQESSNKKDLQESAAKDDFSKEKSGEDGEKDTDKEKKATHLHEDNNDDAEKDGDEADAEDE 160
            |.|.|.| |||       |.:|....|.     |.|.....:..|..|.:|.|............
 Worm    57 ALERCIE-SNK-------AMNDVLNGKM-----KCTTCGATSVGLLSDCHDSATSTTTTVSHRSS 108

  Fly   161 DDVEKPEDEDGTEEGDEAIEEDEDALDEDEDPNEEVEEIEPDFETGTDAEGELITGDEPGDLADV 225
            :  |.|..:.....||    .|::.|:.....:..:..:.....|..:.:....|...|.|:|||
 Worm   109 E--EPPRRKPSAAGGD----HDDEELECSSIESRSIRSVSSSVHTSAEDDETNQTMMVPTDVADV 167

  Fly   226 -------------PIRERKKEEPVDEDQCRVCTSKEELVCLFKKQIDATPADMLLVICPNVSILP 277
                         .......:.|.:|::      :.:||                          
 Worm   168 INAIVAGTNGSSNSNTTSSSKSPQEEEE------EHDLV-------------------------- 200

  Fly   278 KDFMPQFICTKCMGSLTIAIQLRKQLET--TDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSED 340
               |...:.|....|.| .::|.::||.  .|..|..:..::....:.|        .||.:||:
 Worm   201 ---MKSILSTTTSTSNT-KLELSEKLENPLQDTALLDQFLQASLLGQTP--------TVTPASEE 253

  Fly   341 EDELDDEFKV----------SDVAGTTSADSDSADSDDSEKEKKKPGPRGRP------------- 382
            .:|..::..|          :..||....|:.|:::|.| ....:|.|...|             
 Worm   254 NEEDKEQNAVLTSFLQILFANQQAGNAILDAGSSENDGS-TSSSQPSPPADPTASLDSLAMFESL 317

  Fly   383 -----RKKPLKRGTDSDGEPSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRKTHERIE 442
                 ....|...|.|..:.::|:|:|    ||    |.:.|                |:.....
 Worm   318 LAESMNGNVLDANTSSADQKAAARKRK----ST----PMKVP----------------KSENGAG 358

  Fly   443 HACPI--CGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECK 505
            :.||:  |.|.||.:.:...|...|...|  |.|:.|...:..:..|..|  |:...:...|:|:
 Worm   359 YICPMDGCNKVFKEKGSVHRHFVTHIGMR--FNCDKCKASYTQKHALMLH--QKIHANPDAYQCR 419

  Fly   506 RCQRTFLTQQRLQRHQ 521
            .|...:.||..|:.|:
 Worm   420 GCGTNYTTQNGLRLHR 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 11/74 (15%)
zf-C2H2 416..438 CDD:278523 2/21 (10%)
C2H2 Zn finger 418..438 CDD:275368 2/19 (11%)
zf-C2H2 443..465 CDD:278523 7/23 (30%)
C2H2 Zn finger 445..465 CDD:275368 7/21 (33%)
C2H2 Zn finger 474..491 CDD:275368 3/16 (19%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
ztf-6NP_492877.1 zf-C2H2_8 361..434 CDD:292531 21/76 (28%)
C2H2 Zn finger 361..383 CDD:275368 7/21 (33%)
C2H2 Zn finger 390..410 CDD:275368 5/21 (24%)
C2H2 Zn finger 418..435 CDD:275368 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.