DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zscan5b

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_573467.2 Gene:Zscan5b / 170734 MGIID:2159640 Length:468 Species:Mus musculus


Alignment Length:459 Identity:89/459 - (19%)
Similarity:155/459 - (33%) Gaps:142/459 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KEKSGED--GEKDTDKEKKATHLHEDNNDDAEKDGDEADAEDEDDVEKP--EDEDGTEEGDEAIE 180
            |.::.||  |..|..:|    ||..::.:...:.....:.::..:.|:|  ..|:|...|.....
Mouse   139 KAEAAEDKWGHTDFSQE----HLSNESEESLNRGQASRELQNLSETEEPSTSQEEGILLGVIPER 199

  Fly   181 EDEDALDEDEDPNEEVEEIEPDFETGTDAEGELITGDEP----GDLADVPIRERKKEEPVDEDQC 241
            ...|.|..:..|.   .:..||.|   :||..:..|.:|    |....:.::...:.:       
Mouse   200 RQPDYLRPEMSPG---SDSVPDLE---EAEASVFVGQDPLPALGPAGSLGVKGAVQPQ------- 251

  Fly   242 RVCTSKEELVCLFKKQIDATPADMLLVICPNVSILPKDFMPQFICTKCMGSLTIAIQLRKQLETT 306
                  |:.|      :||.|:        ...||.:|                 :.|.:.|::.
Mouse   252 ------EDTV------VDAVPS--------FTHILERD-----------------LALNRDLQSL 279

  Fly   307 DQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDEDELDDEFKVSDVAGTTSADSDSADSDDSEK 371
            .                  |:   :.|.:..            |:...|.|....::|:.     
Mouse   280 S------------------GF---NLPTSQG------------VASYMGNTEDGLEAANP----- 306

  Fly   372 EKKKPGPRGRPRKKPLKRGTDSDGEPSSAQKKKYQPSSTASVGPFECPNCDLTFSRKQSYVLHRK 436
                                    ||::.|.:| |..|.|....|:|..|..:|..|..:.||::
Mouse   307 ------------------------EPANPQPEK-QVDSLAGQARFQCTECKKSFLYKSRFDLHQR 346

  Fly   437 TH--ERIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHG 499
            :|  || ...|.:|.|.|......:.|.:.|..|:. :.||:|...|...:.|:.|......|..
Mouse   347 SHTGER-PFKCILCNKAFVQSSDLRVHQRVHTGEKP-YMCEVCGMEFAHGSTLQGHSRVHTKEKP 409

  Fly   500 FIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVR---IKEEQSRFKQESRSKDDRHHGNNSSKR 561
            |:  ||.|.:.|..:..|..|..:.|      ::|   .|:....|:|:...|  ||...:..||
Mouse   410 FV--CKDCGQRFCHKGNLNVHFRIHC------NLRPYVCKKCNKTFRQQGTWK--RHMKTHLRKR 464

  Fly   562 RPGE 565
            :..|
Mouse   465 KVSE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 10/72 (14%)
zf-C2H2 416..438 CDD:278523 7/21 (33%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 5/21 (24%)
C2H2 Zn finger 445..465 CDD:275368 5/19 (26%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 5/16 (31%)
Zscan5bNP_573467.2 SCAN 33..117 CDD:153421
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
zf-H2C2_2 344..365 CDD:372612 8/21 (38%)
C2H2 Zn finger 356..376 CDD:275368 5/19 (26%)
zf-H2C2_2 368..393 CDD:372612 7/25 (28%)
C2H2 Zn finger 384..404 CDD:275368 6/19 (32%)
zf-H2C2_2 397..419 CDD:372612 7/23 (30%)
zf-C2H2 410..432 CDD:333835 7/23 (30%)
C2H2 Zn finger 412..432 CDD:275368 6/19 (32%)
zf-C2H2 438..460 CDD:333835 6/23 (26%)
C2H2 Zn finger 440..460 CDD:275370 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847323
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.