DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and ZNF573

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001166161.1 Gene:ZNF573 / 126231 HGNCID:26420 Length:665 Species:Homo sapiens


Alignment Length:110 Identity:36/110 - (32%)
Similarity:51/110 - (46%) Gaps:6/110 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 FECPNCDLTFSRKQSYVLHRKTH--ERIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCP 478
            |||..|...:|...:.:.|||||  |: .:.|..|||.|.:......|.:.|...:. :.|::|.
Human   470 FECQECGKAYSTGSNLIQHRKTHTGEK-PYKCKECGKTFSLHGYLNQHQKIHTGMKP-YECKVCR 532

  Fly   479 KIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAV 523
            |.|.....|..|.:...||..|  |||.|.:||.....|..||::
Human   533 KTFTFYRNLTLHQSIHTDEKPF--ECKECGKTFRRSSHLTAHQSI 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071
zf-C2H2 416..438 CDD:278523 8/21 (38%)
C2H2 Zn finger 418..438 CDD:275368 6/19 (32%)
zf-C2H2 443..465 CDD:278523 6/21 (29%)
C2H2 Zn finger 445..465 CDD:275368 6/19 (32%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 6/16 (38%)
ZNF573NP_001166161.1 KRAB 28..89 CDD:214630
KRAB 28..67 CDD:279668
C2H2 Zn finger 136..156 CDD:275368
C2H2 Zn finger 164..184 CDD:275368
C2H2 Zn finger 192..212 CDD:275368
C2H2 Zn finger 220..240 CDD:275368
COG5048 244..628 CDD:227381 36/110 (33%)
C2H2 Zn finger 248..268 CDD:275368
zf-H2C2_2 260..285 CDD:290200
C2H2 Zn finger 276..292 CDD:275368
C2H2 Zn finger 304..324 CDD:275368
C2H2 Zn finger 332..352 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
C2H2 Zn finger 388..408 CDD:275368
zf-H2C2_2 401..424 CDD:290200
C2H2 Zn finger 416..436 CDD:275368
C2H2 Zn finger 444..464 CDD:275368
C2H2 Zn finger 472..492 CDD:275368 6/19 (32%)
zf-H2C2_2 484..508 CDD:290200 10/24 (42%)
C2H2 Zn finger 500..520 CDD:275368 6/19 (32%)
zf-H2C2_2 512..536 CDD:290200 5/24 (21%)
C2H2 Zn finger 528..548 CDD:275368 6/19 (32%)
C2H2 Zn finger 556..576 CDD:275368 8/20 (40%)
C2H2 Zn finger 584..604 CDD:275368
zf-H2C2_2 596..621 CDD:290200
C2H2 Zn finger 612..632 CDD:275368
zf-H2C2_2 624..649 CDD:290200
C2H2 Zn finger 640..660 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.