| Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_446257.1 | Gene: | Snai1 / 116490 | RGDID: | 620758 | Length: | 264 | Species: | Rattus norvegicus |
| Alignment Length: | 199 | Identity: | 51/199 - (25%) |
|---|---|---|---|
| Similarity: | 77/199 - (38%) | Gaps: | 29/199 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 349 KVSDVAGTT--------SADSDSADSDDSEKEKKKPGPRGRPRKKPLKRGTDSDGE--------- 396
Fly 397 PSSAQKKKYQPSSTASVGP-----FECPNCDLTFSRKQSYVLHRKTHERIEHACPICGKKFKVEW 456
Fly 457 AYKTHMQRHEQERAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQ 521
Fly 522 AVGC 525 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12391 | NP_610639.1 | zf-AD | 240..313 | CDD:285071 | |
| zf-C2H2 | 416..438 | CDD:278523 | 4/21 (19%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 3/19 (16%) | ||
| zf-C2H2 | 443..465 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 445..465 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 474..491 | CDD:275368 | 5/16 (31%) | ||
| C2H2 Zn finger | 504..521 | CDD:275368 | 6/16 (38%) | ||
| Snai1 | NP_446257.1 | C2H2 Zn finger | 156..176 | CDD:275368 | 3/19 (16%) |
| COG5048 | <177..>253 | CDD:227381 | 24/78 (31%) | ||
| zf-C2H2 | 180..202 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 182..202 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 195..218 | CDD:290200 | 6/23 (26%) | ||
| zf-C2H2 | 208..230 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 210..230 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 238..255 | CDD:275368 | 6/16 (38%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||