Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598009.1 | Gene: | ZNF274 / 10782 | HGNCID: | 13068 | Length: | 653 | Species: | Homo sapiens |
Alignment Length: | 573 | Identity: | 112/573 - (19%) |
---|---|---|---|
Similarity: | 166/573 - (28%) | Gaps: | 242/573 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 VEKPEDEDGTEEG---DEAIEEDEDALDEDEDP--------NEEVEEI----------------- 199
Fly 200 --EPDFETGTDAEGELI--TGDEPGD--------------------------------------- 221
Fly 222 --------------LADVPIRERKKEEPVDEDQCR---------VCTSKEELV-----------C 252
Fly 253 L------FKKQIDATPADMLLVICPNVSILPK----------DFMPQ--------------FICT 287
Fly 288 KCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAP-----VTDSSED---EDEL 344
Fly 345 DDEFK--VSDVAGTTSADSDSADSDDSEKEK----------------------KKPGPRGR---- 381
Fly 382 -------------PRKKPLKRGTDSDGEPSSAQKKKYQPS------------------STASVGP 415
Fly 416 F----------ECPNCDLTFSRKQSYVLHRKTH--ERIEHACPICGKKFKVEWAYKTHMQRHEQE 468
Fly 469 RAHFRCELCPKIFRLRAELKHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQ 521 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12391 | NP_610639.1 | zf-AD | 240..313 | CDD:285071 | 22/122 (18%) |
zf-C2H2 | 416..438 | CDD:278523 | 6/31 (19%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 5/19 (26%) | ||
zf-C2H2 | 443..465 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 445..465 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 474..491 | CDD:275368 | 4/16 (25%) | ||
C2H2 Zn finger | 504..521 | CDD:275368 | 5/16 (31%) | ||
ZNF274 | NP_598009.1 | KRAB | 14..73 | CDD:214630 | 3/6 (50%) |
KRAB | 14..53 | CDD:279668 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 139..159 | 7/19 (37%) | |||
SCAN | 157..269 | CDD:128708 | 10/111 (9%) | ||
SCAN | 157..245 | CDD:280241 | 6/87 (7%) | ||
KRAB | 287..>327 | CDD:214630 | 4/40 (10%) | ||
KRAB | 287..326 | CDD:279668 | 4/39 (10%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 339..359 | 4/19 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 388..414 | 4/25 (16%) | |||
COG5048 | <389..644 | CDD:227381 | 48/227 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 448..485 | 6/36 (17%) | |||
C2H2 Zn finger | 481..501 | CDD:275368 | 3/20 (15%) | ||
C2H2 Zn finger | 509..529 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 521..546 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 537..557 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 549..573 | CDD:290200 | 7/24 (29%) | ||
zf-C2H2 | 563..585 | CDD:278523 | 7/23 (30%) | ||
C2H2 Zn finger | 565..585 | CDD:275368 | 6/21 (29%) | ||
zf-C2H2 | 591..613 | CDD:278523 | 8/20 (40%) | ||
C2H2 Zn finger | 593..613 | CDD:275368 | 7/18 (39%) | ||
zf-H2C2_2 | 605..630 | CDD:290200 | 4/6 (67%) | ||
C2H2 Zn finger | 621..641 | CDD:275368 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 632..653 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156922 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |