Sequence 1: | NP_610639.1 | Gene: | CG12391 / 36170 | FlyBaseID: | FBgn0033581 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006245901.1 | Gene: | Zfp174 / 102551846 | RGDID: | 7498198 | Length: | 406 | Species: | Rattus norvegicus |
Alignment Length: | 394 | Identity: | 82/394 - (20%) |
---|---|---|---|
Similarity: | 120/394 - (30%) | Gaps: | 132/394 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 247 KEELVCL-------------FKKQI-DATPADMLLVICP----------------NVSILPKDF- 280
Fly 281 ----MPQFICTKCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDE 341
Fly 342 ---DELDDEFKVSDVAGTTSADSDSADSDDSEKEKKKPGP------------RGRPRKKPLKRGT 391
Fly 392 DSDGEPSSA---------------QKKKYQPS-----------STASVGPFECPNCDLTFS---- 426
Fly 427 RKQSYVL----HRKTHERIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAEL 487
Fly 488 KHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQSRFKQESRSKDDR 552
Fly 553 HHGN 556 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12391 | NP_610639.1 | zf-AD | 240..313 | CDD:285071 | 21/100 (21%) |
zf-C2H2 | 416..438 | CDD:278523 | 7/29 (24%) | ||
C2H2 Zn finger | 418..438 | CDD:275368 | 7/27 (26%) | ||
zf-C2H2 | 443..465 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 445..465 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 474..491 | CDD:275368 | 5/16 (31%) | ||
C2H2 Zn finger | 504..521 | CDD:275368 | 4/16 (25%) | ||
Zfp174 | XP_006245901.1 | SCAN | 42..152 | CDD:128708 | 17/91 (19%) |
SCAN | 42..130 | CDD:280241 | 13/68 (19%) | ||
zf-C2H2 | 325..347 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 327..347 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 339..364 | CDD:290200 | 8/25 (32%) | ||
COG5048 | 351..>406 | CDD:227381 | 17/86 (20%) | ||
C2H2 Zn finger | 355..375 | CDD:275368 | 8/21 (38%) | ||
zf-H2C2_2 | 368..392 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 383..403 | CDD:275368 | 5/48 (10%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166350868 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |