DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12391 and Zfp174

DIOPT Version :9

Sequence 1:NP_610639.1 Gene:CG12391 / 36170 FlyBaseID:FBgn0033581 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_006245901.1 Gene:Zfp174 / 102551846 RGDID:7498198 Length:406 Species:Rattus norvegicus


Alignment Length:394 Identity:82/394 - (20%)
Similarity:120/394 - (30%) Gaps:132/394 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 KEELVCL-------------FKKQI-DATPADMLLVICP----------------NVSILPKDF- 280
            :|.|.||             .|:|| :....:..|||.|                .:..|.:|. 
  Rat    61 QEALSCLRQLCRQWLRPELHTKEQILELLVMEQFLVILPPEIQAQVWHRYPKSSREIVTLVEDLH 125

  Fly   281 ----MPQFICTKCMGSLTIAIQLRKQLETTDQELRKRLSRSKNKVRRPRGYVVIDAPVTDSSEDE 341
                .|:...|.||....:.:: :...:..:||||....::.::..:...   ::.|..:.|.::
  Rat   126 TASKKPKQWVTVCMQGQKVLLE-KTGAQLIEQELRDFQPQTPSRDIQENS---LEEPSWERSHEQ 186

  Fly   342 ---DELDDEFKVSDVAGTTSADSDSADSDDSEKEKKKPGP------------RGRPRKKPLKRGT 391
               ...:...........|..:|....|||    |:.|.|            ||||     |.||
  Rat   187 LSPHHWEKSLLQEPALRLTETESSRMRSDD----KENPHPEGTRGAKACTVLRGRP-----KGGT 242

  Fly   392 DSDGEPSSA---------------QKKKYQPS-----------STASVGPFECPNCDLTFS---- 426
            ....||...               |..|..|.           |....||   |..:|..|    
  Rat   243 LHSPEPGGVTASDPRLLQWQVRPPQSPKPLPHYQRHCRELEYISNPLRGP---PLRELKRSRGGR 304

  Fly   427 RKQSYVL----HRKTHERIEHACPICGKKFKVEWAYKTHMQRHEQERAHFRCELCPKIFRLRAEL 487
            |..|.:|    |:..|....:.|..|||.|......|.|.:.|..||.:. |..|...|..::.|
  Rat   305 RSLSSLLQRLGHQAAHSAKPYRCDDCGKSFTWNSELKRHTRVHTGERPYI-CGECGNCFGRQSTL 368

  Fly   488 KHHMAQRHDEHGFIYECKRCQRTFLTQQRLQRHQAVGCQRHKEDSVRIKEEQSRFKQESRSKDDR 552
            |.|  ||.......|:|..|.:.|.....|.:|..:                             
  Rat   369 KLH--QRIHTGEKPYQCSHCGKCFRQSSNLHQHHRL----------------------------- 402

  Fly   553 HHGN 556
            ||||
  Rat   403 HHGN 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12391NP_610639.1 zf-AD 240..313 CDD:285071 21/100 (21%)
zf-C2H2 416..438 CDD:278523 7/29 (24%)
C2H2 Zn finger 418..438 CDD:275368 7/27 (26%)
zf-C2H2 443..465 CDD:278523 7/21 (33%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 474..491 CDD:275368 5/16 (31%)
C2H2 Zn finger 504..521 CDD:275368 4/16 (25%)
Zfp174XP_006245901.1 SCAN 42..152 CDD:128708 17/91 (19%)
SCAN 42..130 CDD:280241 13/68 (19%)
zf-C2H2 325..347 CDD:278523 7/21 (33%)
C2H2 Zn finger 327..347 CDD:275368 7/19 (37%)
zf-H2C2_2 339..364 CDD:290200 8/25 (32%)
COG5048 351..>406 CDD:227381 17/86 (20%)
C2H2 Zn finger 355..375 CDD:275368 8/21 (38%)
zf-H2C2_2 368..392 CDD:290200 9/25 (36%)
C2H2 Zn finger 383..403 CDD:275368 5/48 (10%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.