DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and Cysltr1

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001268788.1 Gene:Cysltr1 / 58861 MGIID:1926218 Length:352 Species:Mus musculus


Alignment Length:350 Identity:67/350 - (19%)
Similarity:117/350 - (33%) Gaps:94/350 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPYTSYQYIYM 137
            |.::..:..:|.:.|...|...:.||.:....|:.....:..||:||:..:.. :|.....|::.
Mouse    38 NQVYSTMYSVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCT-LPLRVVYYVHK 101

  Fly   138 GPGEKDLSYTWA----VCLLVHMHFTQILHT---ISIGLTVTLAVWRYVAIRHPNGGCANFLLAH 195
            |        .|.    :|.|.    |..|:.   .||.....::.:|.|||..|   ..|..|..
Mouse   102 G--------KWLFGDFLCRLT----TYALYVNLYCSIFFMTAMSFFRCVAIVFP---VQNINLVT 151

  Fly   196 SREAILLPFILSPILCLPTY-FV------FQVRETYDVDKVNSEAM----------YHVYFDKDS 243
            .::|        ..:|:..: ||      |.:.::|..:|.|::..          |.:.....|
Mouse   152 QKKA--------RFVCIGIWIFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVS 208

  Fly   244 VLYRFNFWIHSVLIKLLPCGILIVISAVLMHVLCEASRRRLKLRDYNNPAKYAIQLNLNETKSKK 308
            :.:.|          ::|...:||...:::..|                        |..|..|.
Mouse   209 LFFGF----------IIPFVTIIVCYTMIILTL------------------------LKNTMKKN 239

  Fly   309 PPRCDRRNDRTTLLLVAVLVLFLITEFPQGL-----LGLLSGVMEKCFFAHCYPPFGELMDLLAL 368
            .|  .||  :...:::.|...||::..|..:     |.||......|...........:...||.
Mouse   240 MP--SRR--KAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAA 300

  Fly   369 INAAVGFVLYGLMSKQFR---TTFR 390
            .|.....:||......||   :|||
Mouse   301 SNCCFDPLLYFFSGGNFRRRLSTFR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 65/344 (19%)
Cysltr1NP_001268788.1 7tm_4 47..264 CDD:304433 51/278 (18%)
7tm_1 55..310 CDD:278431 57/316 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.