DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and MsR1

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001261324.1 Gene:MsR1 / 38298 FlyBaseID:FBgn0035331 Length:556 Species:Drosophila melanogaster


Alignment Length:419 Identity:161/419 - (38%)
Similarity:219/419 - (52%) Gaps:91/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YCQGEIYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVML 124
            ||...:.|:..:|.::||||||::||.|||||.|||:||||:|| ::|.|.||..|||||:.|||
  Fly    12 YCGSGMDNFHTSYKNMHGYVSLVVCILGTIANTLNIIVLTRREM-RSPTNAILTGLAVADLAVML 75

  Fly   125 EYIPYTSYQYIYMG--PGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNG- 186
            ||||||.:.||...  |.|:.|||:||..:..|..|.|:||||||.||||||||||:|:.:|.. 
  Fly    76 EYIPYTIHDYILTDSLPREEKLSYSWACFIKFHSIFAQVLHTISIWLTVTLAVWRYIAVGYPQKN 140

  Fly   187 ----GCANFLLAHSREAILLPFILSPILCLPTYFVFQVRE--------------TYDVD------ 227
                |....::..:...::...::||.|.|.|.....|.:              .|.:|      
  Fly   141 RVWCGMRTTIITITTAYVVCVLVVSPSLYLITAITEYVDQLDMNGKVINSIPMTQYVIDYRNELL 205

  Fly   228 -----------------------------------------KVNSEAMYHVYFD----KDSVLYR 247
                                                     .|.:..:|.:|..    .::.|..
  Fly   206 SARTAALNATPTSAPLNETVWLNASTLLTSTTTAAPPTPSPVVRNVTVYRLYHSDLALHNASLQN 270

  Fly   248 FNFWIHSVLIKLLPCGILIVISAVLMHVLCEASRRRLKLRDYNNPAKYAIQLNLNETKS------ 306
            ..|.|:||:|||:||..|.::|..|:..|.||.|||.||.  :.||.....   |.|||      
  Fly   271 ATFLIYSVVIKLIPCIALTILSVRLILALLEAKRRRKKLT--SKPATPGAS---NGTKSPANGKA 330

  Fly   307 -------KKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCYPPFGELMD 364
                   .|....:::.||||.:|:|||:||||||||||::|||:.|:...|:..||....:|||
  Fly   331 ADRPRKNSKTLEKEKQTDRTTRMLLAVLLLFLITEFPQGIMGLLNAVLGDVFYLQCYLRLSDLMD 395

  Fly   365 LLALINAAVGFVLYGLMSKQFRTTFRSLF 393
            :|||||:::.|:||..|||||||||..||
  Fly   396 ILALINSSINFILYCSMSKQFRTTFTLLF 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 153/399 (38%)
MsR1NP_001261324.1 7tm_4 30..427 CDD:304433 155/401 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWNV
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I4898
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100685at6656
OrthoFinder 1 1.000 - - FOG0010012
OrthoInspector 1 1.000 - - otm14331
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46273
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X861
77.060

Return to query results.
Submit another query.