DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and GPR142

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_861455.1 Gene:GPR142 / 350383 HGNCID:20088 Length:462 Species:Homo sapiens


Alignment Length:237 Identity:50/237 - (21%)
Similarity:90/237 - (37%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKVN 230
            |:.:.:.|.|.||.|:.||....|......:|.||......:.:..:|.|:...:....|..:..
Human   245 SVWIAILLTVDRYTALCHPLHHRAASSPGRTRRAIAAVLSAALLTGIPFYWWLDMWRDTDSPRTL 309

  Fly   231 SEAMYHVYFDKDSVLYRFNFWIHSVLIKLLPCGILIVISAVLMHVLCEASRRRLKLRDYNNPAKY 295
            .|.:.               |.|.:.:..:|||:.:|.::.::|.|    |||            
Human   310 DEVLK---------------WAHCLTVYFIPCGVFLVTNSAIIHRL----RRR------------ 343

  Fly   296 AIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCY-PPF 359
                    .:|...||.    .::|.:|:.:..||.:...|:..:.|.          |.| .|.
Human   344 --------GRSGLQPRV----GKSTAILLGITTLFTLLWAPRVFVMLY----------HMYVAPV 386

  Fly   360 G---------ELMDLLALINAAVGFVLYGLMSKQFRTTFRSL 392
            .         ::.:::|:::.|..|.||..:||.||.|.|.:
Human   387 HRDWRVHLALDVANMVAMLHTAANFGLYCFVSKTFRATVRQV 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 50/237 (21%)
GPR142NP_861455.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..123
7tm_1 176..414 CDD:278431 42/221 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4901
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.