DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and P2RY10

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001311154.1 Gene:P2RY10 / 27334 HGNCID:19906 Length:364 Species:Homo sapiens


Alignment Length:158 Identity:37/158 - (23%)
Similarity:65/158 - (41%) Gaps:31/158 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQETGN--QMGQTHMHQRVPFNDTVLKDYHLTSTDIEKFVKLWQEYQMKNMTPQVDECQGYCQGE 64
            |.::||  ....|...|....|       |.:..:::|:.:.::.......|.::     ||  .
Human     1 MAQSGNVIMTASTFRPQANALN-------HKSMANLDKYTETFKMGSNSTSTAEI-----YC--N 51

  Fly    65 IYNWLRAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLEYIPY 129
            :.| ::...|::....::|.|.|.:||...:.||.|....|......:..|:|||:..:|. :|.
Human    52 VTN-VKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLS-LPL 114

  Fly   130 TSYQYIYMGPGEKDLSYTW----AVCLL 153
            ..|.||         |:.|    |:|||
Human   115 RIYYYI---------SHHWPFQRALCLL 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 24/80 (30%)
P2RY10NP_001311154.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.