DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and dmsr-10

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_504724.1 Gene:dmsr-10 / 191157 WormBaseID:WBGene00022604 Length:299 Species:Caenorhabditis elegans


Alignment Length:304 Identity:67/304 - (22%)
Similarity:129/304 - (42%) Gaps:65/304 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVADMFVMLE-----YIPYT 130
            :|...|.::...:.||...||||.::||:||||..:.:|..:..:::.|:...:.     |:...
 Worm    37 SYRPFHYFILACVVIFAFFANILILIVLSRKEMRYSGVNVTMMLISICDLVCAIAGLIQLYLRNF 101

  Fly   131 SYQYIYMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAH 195
            |..|         .||..|...|...:|....|..|:.|.:.:|..|.||:......      .:
 Worm   102 SVTY---------TSYIKAYTQLTVDYFQISFHAASLYLALGMAFCRVVAMSSRTDS------RY 151

  Fly   196 SREAILLPFILSPILCLPTYFVFQVRETYDVDKVNSEAMYHVYFDKDSVLYRFN----------- 249
            :.::......::.:||:|. |:|   .:::|      .:.||..:..:::...:           
 Worm   152 TWQSPKYSLRIALLLCIPV-FIF---GSHNV------LLNHVEIENGTIVLNISPLSLANSCLFL 206

  Fly   250 ---FWIHSVLIKLLPCGILIVISAVLMHVLCEASRRRLKLRDYNNPAKYAIQLNLNETKSKKPPR 311
               .:::.:..|::||.:::|:|.|::        .|:|      ..|.|...|...       .
 Worm   207 KLAIFLNGLFFKIVPCILMMVLSFVIL--------ARMK------SGKKASNTNSGN-------H 250

  Fly   312 CDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHC 355
            .|.:..|::..:.||:|:|:|||.|||:|.||.|:....:...|
 Worm   251 IDAQIVRSSRFIQAVIVVFVITEAPQGVLSLLGGLSINDYIKCC 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 65/297 (22%)
dmsr-10NP_504724.1 7tmA_FMRFamide_R-like 40..289 CDD:320109 65/294 (22%)
TM helix 1 42..66 CDD:320109 9/23 (39%)
TM helix 2 75..96 CDD:320109 2/20 (10%)
TM helix 3 115..137 CDD:320109 5/21 (24%)
TM helix 4 161..177 CDD:320109 5/19 (26%)
TM helix 5 207..230 CDD:320109 4/22 (18%)
TM helix 6 256..281 CDD:320109 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343117at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.970

Return to query results.
Submit another query.