DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and dmsr-13

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_504730.1 Gene:dmsr-13 / 188522 WormBaseID:WBGene00020524 Length:362 Species:Caenorhabditis elegans


Alignment Length:363 Identity:86/363 - (23%)
Similarity:148/363 - (40%) Gaps:92/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 WL-----RAYNSIHGYVSLMICIFGTIANILNIMVLTRKEMAKTPINNILKWLAVAD-------- 119
            ||     :||...|.|:...:.:|...|||:.:.||:.|||.::.:|..:..:||.|        
 Worm    29 WLITTVVKAYRPFHYYILTFLVVFAFFANIMIVKVLSHKEMIRSGVNVTMLLIAVCDFGCSIAGL 93

  Fly   120 --MFVMLEYIPYTSYQYIYMGPGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAI- 181
              :|:......||||...|   |:..:.|. ||.          .|..|:.|.|.:|..|..:: 
 Worm    94 LQLFLRSYSDNYTSYPTAY---GQIAVDYL-AVA----------FHASSLYLAVGMAFCRVKSLN 144

  Fly   182 ---------RHPN----GGCANFLLAHSREAILLPFILSPILCLPTYFVFQVRETYDVDKVNSEA 233
                     :.||    ..||               :.:|:..:.|:.:|       ::.|.:..
 Worm   145 IANRNKDLWQSPNYAVRVACA---------------LCAPVFLIATFVLF-------INAVKNTE 187

  Fly   234 MYHVYFD-------KDSVLYRFNFWIHSVLIKLLPCGILIVISAVLMHVLCEASRRRLKLRDYNN 291
            ...:|.|       .:.:..:.:.....:..|:.||.:::|:|..|:        ||:      :
 Worm   188 EEGIYLDISDLSLLSECLFMKASLMASGLCFKIAPCLLMLVLSLFLL--------RRI------D 238

  Fly   292 PAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLITEFPQGLLGLLSGVMEKCFFAHCY 356
            ..|.:.|......|.||.     :.||::..:..|||:|||||.|||:..:|.|.|...:..: :
 Worm   239 EGKQSAQNAAANQKGKKD-----KIDRSSRFIQFVLVVFLITESPQGVFSILGGFMILDYINY-F 297

  Fly   357 PPFGELMDLLALINAAVGFVLYGLMSKQFRTTFRSLFM 394
            ......|::||..|....|::|..:|.:||..|..||:
 Worm   298 QNLSIFMNILAFFNTTTSFIIYSSLSAKFRRIFAQLFL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 79/345 (23%)
dmsr-13NP_504730.1 7tmA_FMRFamide_R-like 40..330 CDD:320109 79/345 (23%)
TM helix 1 42..66 CDD:320109 8/23 (35%)
TM helix 2 75..97 CDD:320109 4/21 (19%)
TM helix 3 115..137 CDD:320109 7/32 (22%)
TM helix 4 161..177 CDD:320109 4/30 (13%)
TM helix 5 208..228 CDD:320109 3/19 (16%)
TM helix 6 259..284 CDD:320109 13/24 (54%)
TM helix 7 298..323 CDD:320109 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWNV
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343117at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.