DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13229 and gpr139

DIOPT Version :9

Sequence 1:NP_001260880.1 Gene:CG13229 / 36168 FlyBaseID:FBgn0033579 Length:414 Species:Drosophila melanogaster
Sequence 2:NP_001308927.1 Gene:gpr139 / 100493863 XenbaseID:XB-GENE-6042001 Length:348 Species:Xenopus tropicalis


Alignment Length:327 Identity:78/327 - (23%)
Similarity:149/327 - (45%) Gaps:65/327 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 YVSLMICIFGTIANILNIMVLTR--KEMAKTPINNILKWLAVADMFVM--LEYIPYTSYQYIYMG 138
            |.|:::|: |..||||.:::|::  ....|:..|.:|. ||.||:.|:  :.::.:....:|.  
 Frog    27 YYSILLCL-GLPANILTVIILSQLVARRQKSSYNYLLA-LAAADIMVLFFIVFVDFLLEDFIL-- 87

  Fly   139 PGEKDLSYTWAVCLLVHMHFTQILHTISIGLTVTLAVWRYVAIRHPNGGCANFLLAHSREAILLP 203
              .|.:.......:.| :.|:.| || ||.:||.|.:.||:|:.||.........|.:|:.|:..
 Frog    88 --NKQMPQMLDKIIEV-LEFSSI-HT-SIWITVPLTIDRYIAVCHPLTYHTVSFPARTRKVIVSV 147

  Fly   204 FILSPILCLPTYFVFQVRETYDVDKVNSEAMYHVYFDKDSVLYRFNFWIHSVLIKLLPCGILIVI 268
            :|...:..:|.|:...:.    ::...|.:::|:.           .|||...:.|:||.|..|:
 Frog   148 YITCFLTSIPYYWWPNIW----IEDYTSTSVHHIL-----------IWIHCFTVYLVPCSIFFVL 197

  Fly   269 SAVLMHVLCEASRRRLKLRDYNNPAKYAIQLNLNETKSKKPPRCDRRNDRTTLLLVAVLVLFLIT 333
            ::::::.|...|  ..:||.|:                         ..:||.:|.::..:|.|.
 Frog   198 NSIIVYKLQRKS--NFRLRGYS-------------------------TGKTTAILFSITSIFAIL 235

  Fly   334 EFPQGLL---GLLSGVMEKCFFAHCYPPFGELMDLLALINAAVGFVLYGLMSKQFRT----TFRS 391
            ..|:.::   .|....:...:..|...   ::.::|||:|.|:.|.||..:||:|||    |.::
 Frog   236 WAPRIIMILYHLYVSPIHNSWLVHIVT---DIANMLALLNTAINFFLYCFISKRFRTMAAGTLKA 297

  Fly   392 LF 393
            .|
 Frog   298 FF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13229NP_001260880.1 7tm_4 78..393 CDD:304433 77/325 (24%)
gpr139NP_001308927.1 7tmA_GPR139 22..291 CDD:320585 76/317 (24%)
TM helix 1 23..49 CDD:320585 9/22 (41%)
TM helix 2 57..82 CDD:320585 7/25 (28%)
TM helix 3 96..126 CDD:320585 13/32 (41%)
TM helix 4 138..158 CDD:320585 4/19 (21%)
TM helix 5 175..200 CDD:320585 9/35 (26%)
TM helix 6 216..248 CDD:320585 7/56 (13%)
TM helix 7 259..284 CDD:320585 9/27 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4738
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D343117at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.