DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and CYC8

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_009670.3 Gene:CYC8 / 852410 SGDID:S000000316 Length:966 Species:Saccharomyces cerevisiae


Alignment Length:459 Identity:102/459 - (22%)
Similarity:177/459 - (38%) Gaps:90/459 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PSDAN-IDWLLHIYFTRREFTRCRRLIERELNRHLNPE---------YLYFVQGLIDREEGNHIE 85
            ||.|. :..|.|:|.:|..|.|...|.||.|  .:|||         :.|.:...:.|....:.:
Yeast    77 PSSAKALTSLAHLYRSRDMFQRAAELYERAL--LVNPELSDVWATLGHCYLMLDDLQRAYNAYQQ 139

  Fly    86 ALRHLQKSAELNPRNIE--------TYKEIGRTLYIMGRFSQALGV---FREAEQRSSRQDHEIY 139
            ||.||.     || |:.        .|...|...|....|::.|.:   |.:|        :|||
Yeast   140 ALYHLS-----NP-NVPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKA--------NEIY 190

  Fly   140 HYLGELLYRAATTQSQ----------KDVASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDK 194
            ..|| ::|:.....||          :..|..|:      :::..|.|..|||.          .
Yeast   191 FRLG-IIYKHQGKWSQALECFRYILPQPPAPLQE------WDIWFQLGSVLESM----------G 238

  Fly   195 QYQKAIEILENCLHLTPENSEVLIEISVLY----LKINETQKAHDRLAEVVSIERKCSPKGLLAF 255
            ::|.|.|..|:.|.....:::||.::..||    ::..:.|||.|.|.:  |:|  ..|.....:
Yeast   239 EWQGAKEAYEHVLAQNQHHAKVLQQLGCLYGMSNVQFYDPQKALDYLLK--SLE--ADPSDATTW 299

  Fly   256 ---GAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNY 317
               |.:...|.|...|...:.|..|.:......|.:||:.:::..::..|:.:..:::.|:|...
Yeast   300 YHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYIS 364

  Fly   318 NALYNLSLIY-IASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENAFVALERASSMA 381
            ...|:|..:| ..:.|.:.|......|..|..:|......|....::|::..|    :.:::...
Yeast   365 EVWYDLGTLYETCNNQLSDALDAYKQAARLDVNNVHIRERLEALTKQLENPGN----INKSNGAP 425

  Fly   382 TGQQGAGRNPLVVLNFALFCYETG---RLALSTEQYNRFMSQAQDLLLPTEYKFQATKLKSLLRI 443
            |....|  .|.|:|...|...:.|   ...:|.:..|...|..|.     ::..|.|.:.|...:
Yeast   426 TNASPA--PPPVILQPTLQPNDQGNPLNTRISAQSANATASMVQQ-----QHPAQQTPINSSATM 483

  Fly   444 SNQG 447
            .:.|
Yeast   484 YSNG 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 18/83 (22%)
TPR repeat 68..95 CDD:276809 6/26 (23%)
TPR_12 97..175 CDD:290160 20/98 (20%)
TPR repeat 100..130 CDD:276809 8/40 (20%)
TPR repeat 136..175 CDD:276809 10/48 (21%)
TPR repeat 179..209 CDD:276809 8/29 (28%)
TPR_19 190..254 CDD:291240 17/67 (25%)
TPR repeat 214..242 CDD:276809 9/31 (29%)
TPR repeat 249..277 CDD:276809 6/30 (20%)
TPR_11 283..348 CDD:290150 13/65 (20%)
TPR repeat 283..311 CDD:276809 4/27 (15%)
TPR repeat 316..346 CDD:276809 6/30 (20%)
TPR repeat 351..377 CDD:276809 3/25 (12%)
CYC8NP_009670.3 TPR <38..142 CDD:223533 19/66 (29%)
TPR repeat 46..74 CDD:276809
TPR repeat 80..108 CDD:276809 11/29 (38%)
TPR 94..391 CDD:223533 74/333 (22%)
TPR repeat 113..143 CDD:276809 4/29 (14%)
TPR repeat 150..178 CDD:276809 4/27 (15%)
TPR repeat 184..211 CDD:276809 9/35 (26%)
TPR repeat 223..253 CDD:276809 10/45 (22%)
TPR repeat 258..290 CDD:276809 10/33 (30%)
TPR repeat 296..324 CDD:276809 5/27 (19%)
TPR repeat 329..359 CDD:276809 4/29 (14%)
TPR repeat 364..393 CDD:276809 6/28 (21%)
Herpes_BLLF1 <697..944 CDD:282904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.