DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and TAH1

DIOPT Version :10

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_009986.1 Gene:TAH1 / 850424 SGDID:S000000656 Length:111 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:18/83 - (21%)
Similarity:35/83 - (42%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 REEGNHI-------EALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQD 135
            :|:||.:       ||:....:.....|:|...|......|..:|.::||:.:.::..:.:|..:
Yeast     8 KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRYTSTAE 72

  Fly   136 HEIYHYLGELLYRAATTQ 153
            |....  .:|.||....|
Yeast    73 HVAIR--SKLQYRLELAQ 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR repeat 68..95 CDD:276809 5/23 (22%)
LapB 70..347 CDD:442196 18/83 (22%)
TPR repeat 100..130 CDD:276809 6/29 (21%)
TPR repeat 136..175 CDD:276809 5/18 (28%)
TPR repeat 179..209 CDD:276809
TPR repeat 214..242 CDD:276809
TPR repeat 249..277 CDD:276809
BepA 281..423 CDD:443813
TPR repeat 283..311 CDD:276809
TPR repeat 316..346 CDD:276809
TPR repeat 351..377 CDD:276809
TAH1NP_009986.1 TPR repeat 8..32 CDD:276809 5/23 (22%)
Spy <11..>66 CDD:443119 11/54 (20%)
TPR repeat 37..67 CDD:276809 6/29 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.