DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and ODAD4

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_113609.1 Gene:ODAD4 / 83538 HGNCID:25280 Length:672 Species:Homo sapiens


Alignment Length:495 Identity:101/495 - (20%)
Similarity:183/495 - (36%) Gaps:127/495 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 IYFTRREFTRCRRLIE----RELNRHLNPEYLYFVQGLIDRE--------EGNHIEALRHLQKSA 94
            ||...|:    |:|::    |:..|..:....|.::.|.|.:        ||:..:|.:.|:|..
Human   245 IYARERD----RKLMQEKWLRDHKRRPSQTAHYILKSLEDIDMLLTSGSAEGSLQKAEKVLKKVL 305

  Fly    95 ELNPRNIETYKEIGRTLY-IMGRFSQALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDV 158
            |.|...:....|:...|| .:|.....||.. ||..:|.|:|.||                    
Human   306 EWNKEEVPNKDELVGNLYSCIGNAQIELGQM-EAALQSHRKDLEI-------------------- 349

  Fly   159 ASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHL---TPENSEVLIEI 220
                   |:.| :|.....|.|::   :..::.:..::|:||:..|..:.|   |.|.:.:..||
Human   350 -------AKEY-DLPDAKSRALDN---IGRVFARVGKFQQAIDTWEEKIPLAKTTLEKTWLFHEI 403

  Fly   221 SVLYLKINET-------QKAHDRLAEVVSIERKCSPKGLLAFGAIL-----QSRNDIDGALSKYS 273
            ...||::::.       :|:.....|...||.:.:...|:|...:.     .:.|:.:.||.:..
Human   404 GRCYLELDQAWQAQNYGEKSQQCAEEEGDIEWQLNASVLVAQAQVKLRDFESAVNNFEKALERAK 468

  Fly   274 QIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAF- 337
            .:.|.|.:               |..|.|:....|.:.......|.:.||.   ..||..||.: 
Human   469 LVHNNEAQ---------------QAIISALDDANKGIIRELRKTNYVENLK---EKSEGEASLYE 515

  Fly   338 -HTLAAAINLRK------------DNAECYMLLGLCLRKLDDMENAFVALERASSMATGQQ---- 385
             ..:....::|:            |::|..       ::.|:.:.||.  |...|.|:|:|    
Human   516 DRIITREKDMRRVRDEPEKVVKQWDHSEDE-------KETDEDDEAFG--EALQSPASGKQSVEA 571

  Fly   386 GAGRNPLVVLNFALF------CYETGRLAL------STEQYNRFMSQAQDLLLPTEYKFQATKLK 438
            |..|:.|..:...|.      ..||||..|      |.|.|.|...:.:..|.....:.:..:||
Human   572 GKARSDLGAVAKGLSGELGTRSGETGRKLLEAGRRESREIYRRPSGELEQRLSGEFSRQEPEELK 636

  Fly   439 SLLRISNQGNGILLDSADMGESDLGHNRATELLPDELPLE 478
            .|..:..:      :..::|::..|....|:...:|:..|
Human   637 KLSEVGRR------EPEELGKTQFGEIGETKKTGNEMEKE 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 16/72 (22%)
TPR repeat 68..95 CDD:276809 8/34 (24%)
TPR_12 97..175 CDD:290160 17/78 (22%)
TPR repeat 100..130 CDD:276809 8/30 (27%)
TPR repeat 136..175 CDD:276809 5/38 (13%)
TPR repeat 179..209 CDD:276809 5/29 (17%)
TPR_19 190..254 CDD:291240 16/73 (22%)
TPR repeat 214..242 CDD:276809 6/34 (18%)
TPR repeat 249..277 CDD:276809 5/32 (16%)
TPR_11 283..348 CDD:290150 11/66 (17%)
TPR repeat 283..311 CDD:276809 4/27 (15%)
TPR repeat 316..346 CDD:276809 7/31 (23%)
TPR repeat 351..377 CDD:276809 5/25 (20%)
ODAD4NP_113609.1 TPR 1. /evidence=ECO:0000255 13..46
TPR_11 16..78 CDD:290150
TPR repeat 16..41 CDD:276809
TPR repeat 46..76 CDD:276809
TPR 2. /evidence=ECO:0000255 48..80
TPR_11 49..112 CDD:290150
TPR 3. /evidence=ECO:0000255 81..114
TPR repeat 81..109 CDD:276809
TPR 4. /evidence=ECO:0000255 275..311 9/35 (26%)
TPR repeat 311..349 CDD:276809 11/38 (29%)
TPR_12 316..385 CDD:290160 21/100 (21%)
TPR 5. /evidence=ECO:0000255 320..353 13/60 (22%)
TPR 6. /evidence=ECO:0000255 360..393 7/35 (20%)
TPR repeat 360..385 CDD:276809 5/27 (19%)
TPR_12 361..429 CDD:290160 14/70 (20%)
TPR 7. /evidence=ECO:0000255 397..430 5/32 (16%)
TPR_12 398..468 CDD:290160 13/69 (19%)
TPR repeat 431..465 CDD:276809 6/33 (18%)
TPR 8. /evidence=ECO:0000255 437..470 5/32 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 527..672 32/159 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.