DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and LONRF3

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_005262533.1 Gene:LONRF3 / 79836 HGNCID:21152 Length:811 Species:Homo sapiens


Alignment Length:420 Identity:78/420 - (18%)
Similarity:133/420 - (31%) Gaps:147/420 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GRFSQALGVFREAEQRS---SRQDHEIYHYL------GELLYRAATTQ---SQKDVASQQQDEAR 167
            ||..:||.|:|:..:|.   :.|..::...|      ||.|..|...:   :...||:::...|.
Human    81 GRIREALEVYRQLSERQQLVAEQLEQLVRCLAEKVPQGEALAPAPPDEGSTASGTVAAEETGAAA 145

  Fly   168 TYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQK 232
            ......|..|.|                          |                        :|
Human   146 AAAATEVWDGFK--------------------------C------------------------RK 160

  Fly   233 AHDRLAEVVSI-----------------ERKCSPKG------LLAFGAILQSRND---------- 264
            .|..|::.||:                 :|:|:..|      ::|.|....:|..          
Human   161 CHGFLSDPVSLSCGHTFCKLCLERGRAADRRCALCGVKLSALMVATGRARGARRAGQQPPPPLRV 225

  Fly   265 ---IDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALY-NLSL 325
               :.|.|.|..    ..|..|....:.|...:::::...|:....::|.|:| |.:.|| |.|.
Human   226 NVVLSGLLGKLF----PGPARASQLRHEGNRLYRERQVEAALLKYNEAVKLAP-NDHLLYSNRSQ 285

  Fly   326 IYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENAFVALERASSMATGQQGAGRN 390
            ||...|.:.:|.|....|..||....:.:......|..|..:|.|                    
Human   286 IYFTLESHENALHDAEIACKLRPMGFKAHFRKAQALATLGKVEEA-------------------- 330

  Fly   391 PLVVLNFALFCYETGRLALSTEQYN-RFMSQAQDLLL-------PTEYKFQATKLKSLLRISNQG 447
                |...|:|       :|.:..| |...:||.|||       |.:.:..:..:..||....: 
Human   331 ----LREFLYC-------VSLDGKNKRARCEAQRLLLSFFSPSVPGDSQEHSPDILKLLAPHPR- 383

  Fly   448 NGILLDSADMGESDLGHNRATELLPDELPL 477
               |.::.:...:::..:....||.|.|.|
Human   384 ---LKENVESMTTEVTSHNLPRLLQDNLEL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 6/11 (55%)
TPR repeat 68..95 CDD:276809
TPR_12 97..175 CDD:290160 16/71 (23%)
TPR repeat 100..130 CDD:276809 6/14 (43%)
TPR repeat 136..175 CDD:276809 8/47 (17%)
TPR repeat 179..209 CDD:276809 2/29 (7%)
TPR_19 190..254 CDD:291240 9/86 (10%)
TPR repeat 214..242 CDD:276809 3/27 (11%)
TPR repeat 249..277 CDD:276809 7/46 (15%)
TPR_11 283..348 CDD:290150 18/65 (28%)
TPR repeat 283..311 CDD:276809 3/27 (11%)
TPR repeat 316..346 CDD:276809 11/30 (37%)
TPR repeat 351..377 CDD:276809 4/25 (16%)
LONRF3XP_005262533.1 RING 158..195 CDD:302633 8/60 (13%)
TPR_11 242..308 CDD:290150 18/66 (27%)
TPR repeat 243..271 CDD:276809 3/27 (11%)
TPR repeat 276..306 CDD:276809 10/29 (34%)
TPR repeat 311..334 CDD:276809 5/46 (11%)
RING 518..557 CDD:238093
LON_substr_bdg 607..808 CDD:280370
LON 618..796 CDD:271862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.