DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment BBS4 and Ttc32

DIOPT Version :9

Sequence 1:	NP_610636.1	Gene:	BBS4 / 36167	FlyBaseID:	FBgn0033578	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_083597.1	Gene:	Ttc32 / 75516	MGIID:	1922766	Length:	148	Species:	Mus musculus

Alignment Length:	93	Identity:	26/93 - (27%)
Similarity:	38/93 - (40%)	Gaps:	9/93 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    44 FTRREFTRCRRLIER---ELNRH---LNPEYL---YFVQGLIDREEGNHIEALRHLQKSAELNPR 99
            |:|.||...|.|...   :..||   .:||.|   |..:|.......:..||:.....:.|:.|.
Mouse    23 FSRGEFAEARELYSAFIGQCARHGSKCSPEDLATAYNNRGQTKYFSVDFYEAMDDYTSAIEILPS 87

  Fly   100 NIETYKEIGRTLYIMGRFSQALGVFREA 127
            ....|...|...|.:|.|.:||..|::|
Mouse    88 FEVPYYNRGLIRYRLGYFDEALEDFKKA 115

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
BBS4	NP_610636.1	TPR_12	63..127	CDD:290160	18/69 (26%)
		TPR repeat	68..95	CDD:276809	5/29 (17%)
		TPR_12	97..175	CDD:290160	10/31 (32%)
		TPR repeat	100..130	CDD:276809	9/28 (32%)
		TPR repeat	136..175	CDD:276809
		TPR repeat	179..209	CDD:276809
		TPR_19	190..254	CDD:291240
		TPR repeat	214..242	CDD:276809
		TPR repeat	249..277	CDD:276809
		TPR_11	283..348	CDD:290150
		TPR repeat	283..311	CDD:276809
		TPR repeat	316..346	CDD:276809
		TPR repeat	351..377	CDD:276809
Ttc32	NP_083597.1	TPR_11	11..86	CDD:290150	16/62 (26%)
		TPR 1	12..45		6/21 (29%)
		TPR_11	55..120	CDD:290150	15/61 (25%)
		TPR 2	55..88		6/32 (19%)
		TPR repeat	55..83	CDD:276809	4/27 (15%)
		TPR repeat	88..118	CDD:276809	9/28 (32%)
		TPR 3	89..122		9/27 (33%)
		TPR_1	92..122	CDD:278916	9/24 (38%)
		TPR repeat	123..148	CDD:276809
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900