DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment BBS4 and Ttc32

DIOPT Version :9

Sequence 1:	NP_610636.1	Gene:	BBS4 / 36167	FlyBaseID:	FBgn0033578	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	XP_003750178.1	Gene:	Ttc32 / 684830	RGDID:	1585566	Length:	148	Species:	Rattus norvegicus

Alignment Length:	143	Identity:	35/143 - (24%)
Similarity:	53/143 - (37%)	Gaps:	32/143 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly    98 PRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYH-YLGELLYRAATTQSQKDVASQ 161
            ||..|..:..........||  |.|.|.||        .|:|. ::|:.....:.. |.:|:|:.
  Rat     4 PRGRERGESPAALAMAQARF--ARGDFTEA--------RELYSAFIGQCASHRSKC-SPEDLATA 57

  Fly   162 QQDEART-YFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYL 225
            ..:..:| ||.:               :.|.....|..|||||.|  ...|..:..||...:.|.
  Rat    58 YNNRGQTKYFSV---------------DFYEAMDDYTSAIEILPN--FEVPYYNRGLIRYRLGYF 105

  Fly   226 --KINETQKAHDR 236
              .:.:.:||.||
  Rat   106 DEAVEDFKKALDR 118

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
BBS4	NP_610636.1	TPR_12	63..127	CDD:290160	8/28 (29%)
		TPR repeat	68..95	CDD:276809
		TPR_12	97..175	CDD:290160	19/78 (24%)
		TPR repeat	100..130	CDD:276809	8/29 (28%)
		TPR repeat	136..175	CDD:276809	9/40 (23%)
		TPR repeat	179..209	CDD:276809	8/29 (28%)
		TPR_19	190..254	CDD:291240	16/49 (33%)
		TPR repeat	214..242	CDD:276809	7/25 (28%)
		TPR repeat	249..277	CDD:276809
		TPR_11	283..348	CDD:290150
		TPR repeat	283..311	CDD:276809
		TPR repeat	316..346	CDD:276809
		TPR repeat	351..377	CDD:276809
Ttc32	XP_003750178.1	TPR_11	14..86	CDD:290150	22/97 (23%)
		TPR repeat	14..48	CDD:276809	10/43 (23%)
		TPR repeat	53..84	CDD:276809	9/45 (20%)
		TPR_11	55..120	CDD:290150	20/81 (25%)
		TPR_1	55..88	CDD:278916	12/49 (24%)
		TPR repeat	89..117	CDD:276809	6/27 (22%)
		TPR_1	92..120	CDD:278916	7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900