DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and SPAG1

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_016869243.1 Gene:SPAG1 / 6674 HGNCID:11212 Length:961 Species:Homo sapiens


Alignment Length:430 Identity:95/430 - (22%)
Similarity:163/430 - (37%) Gaps:86/430 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLGELLY--RAATTQSQKDVA 159
            ||..:   |..|..|:..|:|::|.|.:..|.........||...| .:||  |||....:.:.:
Human   479 NPAGL---KSQGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDL-SILYSNRAACYLKEGNCS 539

  Fly   160 SQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAI----EILE-NC-LHLTPEN----S 214
            ...||..|. .||...|.:.|   :|.|..|...:||.||.    .:|: :| |.|..::    |
Human   540 GCIQDCNRA-LELHPFSMKPL---LRRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLS 600

  Fly   215 EVLIEIS----------VLYLKINETQKAHDRLAEVVSIERKCS----PKGLL---AFGAILQSR 262
            .:|:|:.          :..:..:...:|.....|::|.:...|    .:|:.   .|.|:.:..
Human   601 RILMELDGPNWREKLSPIPAVPASVPLQAWHPAKEMISKQAGDSSSHRQQGITDEKTFKALKEEG 665

  Fly   263 N------DIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALY 321
            |      :...||||||:......:...::.|..||:.|..:|..|.....:::.|:..|..|.|
Human   666 NQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEEAKQDCDQALQLADGNVKAFY 730

  Fly   322 NLSLIYIASEQYASAFHTLAAAINLRKDNAECYM-------LLGLC-----------LRKLD--- 365
            ..:|.:...:.|..:...|...|.|.....|..|       ||.|.           .||::   
Human   731 RRALAHKGLKNYQKSLIDLNKVILLDPSIIEAKMELEEVTRLLNLKDKTAPFNKEKERRKIEIQE 795

  Fly   366 -------------DMENAFVALERASSMATGQQGAGRNPLVVLNFALFCYETGRL--ALSTEQYN 415
                         ::....:|.|:....:...:...:.|:...|.|   ||.|::  ||||.:..
Human   796 VNEGKEEPGRPAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPNNA---YEFGQIINALSTRKDK 857

  Fly   416 RFMSQAQDLLLPTEY-KFQATKLKS---LLRISNQGNGIL 451
            ...:....:..|.:. .|.:.||:.   ||.|.:..|.::
Human   858 EACAHLLAITAPKDLPMFLSNKLEGDTFLLLIQSLKNNLI 897

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 9/29 (31%)
TPR repeat 68..95 CDD:276809
TPR_12 97..175 CDD:290160 23/79 (29%)
TPR repeat 100..130 CDD:276809 8/29 (28%)
TPR repeat 136..175 CDD:276809 13/40 (33%)
TPR repeat 179..209 CDD:276809 11/35 (31%)
TPR_19 190..254 CDD:291240 17/90 (19%)
TPR repeat 214..242 CDD:276809 5/37 (14%)
TPR repeat 249..277 CDD:276809 10/36 (28%)
TPR_11 283..348 CDD:290150 15/64 (23%)
TPR repeat 283..311 CDD:276809 6/27 (22%)
TPR repeat 316..346 CDD:276809 7/29 (24%)
TPR repeat 351..377 CDD:276809 9/59 (15%)
SPAG1XP_016869243.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.