DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Ifit3b

DIOPT Version :10

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006527327.1 Gene:Ifit3b / 667370 MGIID:3698419 Length:428 Species:Mus musculus


Alignment Length:347 Identity:76/347 - (21%)
Similarity:135/347 - (38%) Gaps:82/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYEPGTEQINCNGRLIELPTLEVVRPAPKMPSDANIDWLLHIYFTRREFTRCRRLIERELNR--H 63
            |..||..:..|.   :...:||.:.|..|    .:..|.|.     ||.:....:.:|..|:  |
Mouse    17 MLWPGHRRSQCE---VNRESLEAILPQLK----CHFTWNLF-----REGSMSSHMEDRVCNQLEH 69

  Fly    64 LNPE---YLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTL---------YIMGR 116
            ||.|   .:|.:...|...:|....||..|.::.:|.....:...||.|.:         |.|||
Mouse    70 LNSEEKATMYDLLAYIKHLDGESKAALECLGQAEDLRKSEHKDQAEIRRLVTWGNYAWIYYHMGR 134

  Fly   117 FSQALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQ------ 175
            .|:|.....:..|...:..:.......||......|:    :...:.:.|:..||.|::      
Mouse   135 LSEAQAYVDKVRQVCQKFANPYSMECPELECEEGWTR----LKCGRNERAKMCFEKALEEKPKDP 195

  Fly   176 ---SGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRL 237
               ||..:..: ||.|  :.:||:  :::.|:..:.|.|:|..|.:.:::..|::.|..:. :||
Mouse   196 ECSSGMAIAMF-RLEE--KPEKQF--SVDALKQAMELNPQNQYVKVLLALKLLRMGEEAEG-ERL 254

  Fly   238 AEVVSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQ-KFIV 301
            .:                .|:.::.|..| .|.|.:|                  |:||: ....
Mouse   255 IK----------------DALGKAPNQTD-VLQKAAQ------------------FYKKKGNLDR 284

  Fly   302 AISSLRKSVWLSPLNYNALYNL 323
            ||..|.|:: .|.:|.:.||:|
Mouse   285 AIELLGKAL-RSTVNNSPLYSL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR repeat 68..95 CDD:276809 6/26 (23%)
LapB 70..347 CDD:442196 58/273 (21%)
TPR repeat 100..130 CDD:276809 9/38 (24%)
TPR repeat 136..175 CDD:276809 7/38 (18%)
TPR repeat 179..209 CDD:276809 6/29 (21%)
TPR repeat 214..242 CDD:276809 5/27 (19%)
TPR repeat 249..277 CDD:276809 6/27 (22%)
BepA 281..423 CDD:443813 12/44 (27%)
TPR repeat 283..311 CDD:276809 7/28 (25%)
TPR repeat 316..346 CDD:276809 4/8 (50%)
TPR repeat 351..377 CDD:276809
Ifit3bXP_006527327.1 TPR_12 76..151 CDD:315987 17/74 (23%)
TPR repeat 76..104 CDD:276809 6/27 (22%)
TPR repeat 109..148 CDD:276809 9/38 (24%)
TPR 121..362 CDD:440225 48/231 (21%)
TPR repeat 161..189 CDD:276809 7/31 (23%)
TPR repeat 194..227 CDD:276809 8/37 (22%)
TPR repeat 266..294 CDD:276809 11/47 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.