DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and FKBPL

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_071393.2 Gene:FKBPL / 63943 HGNCID:13949 Length:349 Species:Homo sapiens


Alignment Length:119 Identity:30/119 - (25%)
Similarity:48/119 - (40%) Gaps:21/119 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CNGRLIELPTLEVVRPAPKMPSDANIDWLLHIYFTRREF---------TRCRRLIERELNRHLNP 66
            |.||.:.   |.:..|.|..|...    :||......:.         ..|.|::|||.. ||..
Human   232 CYGRALR---LLLTLPPPGPPERT----VLHANLAACQLLLGQPQLAAQSCDRVLEREPG-HLKA 288

  Fly    67 EYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQA 120
            .|.   :|:.....||..:|...|:|...::|:|....:|:|:.: |.|:...|
Human   289 LYR---RGVAQAALGNLEKATADLKKVLAIDPKNRAAQEELGKVV-IQGKNQDA 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 16/58 (28%)
TPR repeat 68..95 CDD:276809 7/26 (27%)
TPR_12 97..175 CDD:290160 7/24 (29%)
TPR repeat 100..130 CDD:276809 6/21 (29%)
TPR repeat 136..175 CDD:276809
TPR repeat 179..209 CDD:276809
TPR_19 190..254 CDD:291240
TPR repeat 214..242 CDD:276809
TPR repeat 249..277 CDD:276809
TPR_11 283..348 CDD:290150
TPR repeat 283..311 CDD:276809
TPR repeat 316..346 CDD:276809
TPR repeat 351..377 CDD:276809
FKBPLNP_071393.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..55
TPR_11 187..>348 CDD:330823 30/119 (25%)
TPR 1 210..243 4/13 (31%)
TPR repeat 210..238 CDD:276809 3/5 (60%)
TPR repeat 251..281 CDD:276809 4/33 (12%)
TPR 2 252..285 7/37 (19%)
TPR 3 286..319 9/35 (26%)
TPR repeat 286..314 CDD:276809 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.