DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and ifit10

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001287801.1 Gene:ifit10 / 567441 ZFINID:ZDB-GENE-121214-248 Length:482 Species:Danio rerio


Alignment Length:437 Identity:84/437 - (19%)
Similarity:143/437 - (32%) Gaps:120/437 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQAL 121
            :|.|...|:....:|...|| :::.:..:.|..|::...|   ::|..:.:.||...:......|
Zfish    11 DRALRTKLHQLECHFTWALI-KDDIDINDLLNRLEEQINL---DLEKKERLARTYSALAYVQYLL 71

  Fly   122 GVFREAEQ--RSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRKLESYV 184
            |...:|.|  .:|::.|...|  |:..||..                             :.:|.
Zfish    72 GFHEKAHQSLMTSKKLHIESH--GDEFYRTL-----------------------------IVTYG 105

  Fly   185 RLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVVSIERKCSP 249
            .||.|....|.|.:....| |.|.                 :||||..     ||..||......
Zfish   106 NLAWLNYHMKNYTECESYL-NSLQ-----------------RINETSP-----AEFSSIPEVLGE 147

  Fly   250 KG--LLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQ------KFIVAISSL 306
            ||  .|.|     ||...|||...:.:....|||..|......:..::.:      :....:..|
Zfish   148 KGWTFLKF-----SRKYYDGAKECFRKAVELEPEEPEWHTGYAIALYRTEFESTVLEDSATVKQL 207

  Fly   307 RKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENAF 371
            |.::.::|.:......|||..|..::|..|...:..|:....|:......:|...|....::.:.
Zfish   208 RLAIEMNPDDDVLKVLLSLRLIVYKRYGEAESWVEKALEKSPDHPHVMRYVGKFFRNKGCVDRSI 272

  Fly   372 VALERASSMATGQQGAGRNPLVVLNFALFCYETGRLALSTEQYNR-------------------- 416
            ..|:||...:.       |...:.:....||:..::.:..||.:.                    
Zfish   273 DLLKRALERSP-------NSSFIHHQLALCYKYKKIQVLQEQSHHARGSRVQQLRDQCIFHLEKA 330

  Fly   417 ------FMSQAQDLLLP---------TEYKFQATKLKSLLRISNQGN 448
                  |:|...||.|.         .|..||.|     .:|:.:.|
Zfish   331 TSLTTSFISAMSDLALQYGENGDIPRAEELFQVT-----FKIAKEKN 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 12/63 (19%)
TPR repeat 68..95 CDD:276809 5/26 (19%)
TPR_12 97..175 CDD:290160 13/79 (16%)
TPR repeat 100..130 CDD:276809 7/31 (23%)
TPR repeat 136..175 CDD:276809 5/38 (13%)
TPR repeat 179..209 CDD:276809 9/29 (31%)
TPR_19 190..254 CDD:291240 15/65 (23%)
TPR repeat 214..242 CDD:276809 6/27 (22%)
TPR repeat 249..277 CDD:276809 9/29 (31%)
TPR_11 283..348 CDD:290150 11/70 (16%)
TPR repeat 283..311 CDD:276809 3/33 (9%)
TPR repeat 316..346 CDD:276809 7/29 (24%)
TPR repeat 351..377 CDD:276809 3/25 (12%)
ifit10NP_001287801.1 TPR repeat 58..86 CDD:276809 7/27 (26%)
TPR repeat 91..130 CDD:276809 13/87 (15%)
TPR repeat 142..172 CDD:276809 9/34 (26%)
TPR repeat 177..213 CDD:276809 3/35 (9%)
TPR repeat 251..281 CDD:276809 5/29 (17%)
TPR repeat 338..362 CDD:276809 5/23 (22%)
TPR repeat 375..406 CDD:276809
TPR repeat 411..463 CDD:276809
TPR_1 436..468 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.