DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and ogt

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_012823955.1 Gene:ogt / 553157 XenbaseID:XB-GENE-966145 Length:1045 Species:Xenopus tropicalis


Alignment Length:339 Identity:70/339 - (20%)
Similarity:132/339 - (38%) Gaps:50/339 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEI 138
            |.:...:|....|:.|.:|:..|:|..::.|..:|..|.....|.:|:..:..|  .|...:|.:
 Frog   198 GCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRA--LSLSPNHAV 260

  Fly   139 YHYLGELLYRAATTQSQKDVASQQQDEARTYFE-----LAVQSGRKL--------ESYVRLAELY 190
            .|  |.|                    |..|:|     ||:.:.|:.        ::|..||...
 Frog   261 VH--GNL--------------------ACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANAL 303

  Fly   191 RKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVVSIERKC---SPKGL 252
            ::......|.|.....|.|.|.:::.|..::       ..::....:.|.|.:.||.   .|:..
 Frog   304 KEKGSVVDAEECYNTALRLCPTHADSLNNLA-------NIKREQGNIEEAVRLYRKALEVFPEFA 361

  Fly   253 LA---FGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSP 314
            .|   ..::||.:..:..||..|.:.....|..|:.::|:|....:.|....|:....:::.::|
 Frog   362 AAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINP 426

  Fly   315 LNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENAFVALERASS 379
            ...:|..||:.|:..|.....|..:...|:.|:.|..:.|..|..||:.:.|..:....:::..|
 Frog   427 AFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVS 491

  Fly   380 MATGQQGAGRNPLV 393
            :...|....|.|.|
 Frog   492 IVADQLEKNRLPSV 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 12/52 (23%)
TPR repeat 68..95 CDD:276809 5/20 (25%)
TPR_12 97..175 CDD:290160 17/82 (21%)
TPR repeat 100..130 CDD:276809 6/29 (21%)
TPR repeat 136..175 CDD:276809 9/43 (21%)
TPR repeat 179..209 CDD:276809 6/37 (16%)
TPR_19 190..254 CDD:291240 11/66 (17%)
TPR repeat 214..242 CDD:276809 2/27 (7%)
TPR repeat 249..277 CDD:276809 7/30 (23%)
TPR_11 283..348 CDD:290150 14/64 (22%)
TPR repeat 283..311 CDD:276809 5/27 (19%)
TPR repeat 316..346 CDD:276809 7/29 (24%)
TPR repeat 351..377 CDD:276809 5/25 (20%)
ogtXP_012823955.1 PEP_TPR_lipo <22..>465 CDD:274350 60/297 (20%)
TPR repeat 24..49 CDD:276809
TPR repeat 57..83 CDD:276809
TPR repeat 89..117 CDD:276809
TPR repeat 122..152 CDD:276809
TPR repeat 157..185 CDD:276809
TPR repeat 191..219 CDD:276809 5/20 (25%)
TPR repeat 226..253 CDD:276809 6/28 (21%)
TPR repeat 259..287 CDD:276809 9/49 (18%)
TPR repeat 293..321 CDD:276809 5/27 (19%)
TPR repeat 327..355 CDD:276809 5/34 (15%)
TPR repeat 360..390 CDD:276809 6/29 (21%)
TPR repeat 395..423 CDD:276809 5/27 (19%)
TPR repeat 429..457 CDD:276809 7/27 (26%)
Glyco_transf_41 556..1023 CDD:372753
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.