DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Fkbpl

DIOPT Version :10

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001002818.1 Gene:Fkbpl / 406168 RGDID:1303227 Length:347 Species:Rattus norvegicus


Alignment Length:131 Identity:31/131 - (23%)
Similarity:52/131 - (39%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYEPGTEQ--INCNGRLIELPTLEVVRPAPKMPSDANIDWLLHIYFTRREF---------TRCRR 54
            ::..|..|  ..|.||.:.   |.:..|.|..|...    :||......:.         ..|.|
  Rat   218 LFRAGNPQGAARCYGRALR---LLLTLPPPGPPERT----ILHANLAACQLLLGHPQLAAQSCDR 275

  Fly    55 LIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQ 119
            ::|||.. ||...|.   :|:.....|:..:|...|:|...::|:|....:|:|:.: |.|:...
  Rat   276 VLEREPG-HLKALYR---RGVAQAALGDLDKATADLKKVLAVDPKNRAAKEELGKVV-IQGKIQD 335

  Fly   120 A 120
            |
  Rat   336 A 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR repeat 68..95 CDD:276809 6/26 (23%)
LapB 70..347 CDD:442196 12/51 (24%)
TPR repeat 100..130 CDD:276809 6/21 (29%)
TPR repeat 136..175 CDD:276809
TPR repeat 179..209 CDD:276809
TPR repeat 214..242 CDD:276809
TPR repeat 249..277 CDD:276809
BepA 281..423 CDD:443813
TPR repeat 283..311 CDD:276809
TPR repeat 316..346 CDD:276809
TPR repeat 351..377 CDD:276809
FkbplNP_001002818.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
TPR 1 208..241 6/25 (24%)
TPR repeat 208..236 CDD:276809 5/17 (29%)
TPR 212..>336 CDD:440225 30/129 (23%)
TPR repeat 249..279 CDD:276809 4/33 (12%)
TPR 2 250..283 7/37 (19%)
TPR 3 284..317 8/35 (23%)
TPR repeat 284..312 CDD:276809 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.