Sequence 1: | NP_610636.1 | Gene: | BBS4 / 36167 | FlyBaseID: | FBgn0033578 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_945318.2 | Gene: | Tmtc1 / 387314 | MGIID: | 3039590 | Length: | 942 | Species: | Mus musculus |
Alignment Length: | 338 | Identity: | 69/338 - (20%) |
---|---|---|---|
Similarity: | 116/338 - (34%) | Gaps: | 118/338 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 LNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNP------------------------------ 98
Fly 99 ---RNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVAS 160
Fly 161 QQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYL 225
Fly 226 KINETQKAHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIG 290
Fly 291 LCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYM 355
Fly 356 LLGLCLRKLDDME 368 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BBS4 | NP_610636.1 | TPR_12 | 63..127 | CDD:290160 | 21/95 (22%) |
TPR repeat | 68..95 | CDD:276809 | 8/26 (31%) | ||
TPR_12 | 97..175 | CDD:290160 | 19/110 (17%) | ||
TPR repeat | 100..130 | CDD:276809 | 11/29 (38%) | ||
TPR repeat | 136..175 | CDD:276809 | 5/38 (13%) | ||
TPR repeat | 179..209 | CDD:276809 | 10/29 (34%) | ||
TPR_19 | 190..254 | CDD:291240 | 12/63 (19%) | ||
TPR repeat | 214..242 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 249..277 | CDD:276809 | 5/27 (19%) | ||
TPR_11 | 283..348 | CDD:290150 | 10/64 (16%) | ||
TPR repeat | 283..311 | CDD:276809 | 6/27 (22%) | ||
TPR repeat | 316..346 | CDD:276809 | 3/29 (10%) | ||
TPR repeat | 351..377 | CDD:276809 | 5/18 (28%) | ||
Tmtc1 | NP_945318.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 245..285 | ||
DUF1736 | 351..425 | CDD:285594 | |||
TPR_11 | 542..605 | CDD:290150 | |||
TPR 1 | 543..576 | ||||
TPR_2 | 543..576 | CDD:285020 | |||
TPR repeat | 543..571 | CDD:276809 | |||
TPR repeat | 576..603 | CDD:276809 | |||
TPR 2 | 577..607 | ||||
TPR | 577..607 | CDD:197478 | |||
TPR_17 | 596..628 | CDD:290167 | |||
TPR 3 | 608..641 | ||||
TPR repeat | 608..636 | CDD:276809 | |||
TPR | 621..940 | CDD:223533 | 69/338 (20%) | ||
TPR 4 | 642..675 | ||||
TPR repeat | 642..670 | CDD:276809 | |||
TPR repeat | 675..705 | CDD:276809 | 9/31 (29%) | ||
TPR 5 | 676..709 | 11/35 (31%) | |||
TPR 6 | 710..742 | 0/31 (0%) | |||
TPR repeat | 710..738 | CDD:276809 | 0/27 (0%) | ||
TPR_7 | 715..744 | CDD:289919 | 1/28 (4%) | ||
TPR 7 | 743..776 | 11/32 (34%) | |||
TPR repeat | 743..771 | CDD:276809 | 11/27 (41%) | ||
TPR_14 | 749..786 | CDD:290164 | 13/37 (35%) | ||
TPR repeat | 776..806 | CDD:276809 | 6/40 (15%) | ||
TPR 8 | 811..844 | 12/32 (38%) | |||
TPR repeat | 812..839 | CDD:276809 | 8/26 (31%) | ||
TPR repeat | 844..878 | CDD:276809 | 9/64 (14%) | ||
TPR 9 | 849..882 | 9/63 (14%) | |||
TPR 10 | 883..916 | 9/60 (15%) | |||
TPR_1 | 883..915 | CDD:278916 | 9/59 (15%) | ||
TPR repeat | 883..911 | CDD:276809 | 8/55 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |