DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc1

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_945318.2 Gene:Tmtc1 / 387314 MGIID:3039590 Length:942 Species:Mus musculus


Alignment Length:338 Identity:69/338 - (20%)
Similarity:116/338 - (34%) Gaps:118/338 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNP------------------------------ 98
            |:..|..|   |:|  .|...:|:.|.|::.:|:|                              
Mouse   678 LHNNYAVF---LVD--SGFPEKAVAHYQQAIQLSPSHHVAVVNLGRLYRSLGENSKAEEWYRRAL 737

  Fly    99 ---RNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVAS 160
               |..|....:|...|..||..:||.|:|||......| .|:...|.::|.....|:..:.:.|
Mouse   738 KVARTAEVLSPLGALYYNTGRHKEALEVYREAVSLQPSQ-RELRLALAQVLAVMGQTKEAEKITS 801

  Fly   161 QQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYL 225
                      .:..:..|.||.|..|:.::.|.:.:.||:|.:|..|.|.|::.:|:.|:  .:.
Mouse   802 ----------HIVSEEPRCLECYRLLSAIHSKQEHHGKALEAIEKALQLKPKDPKVISEL--FFT 854

  Fly   226 KINETQKAHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIG 290
            |.|:                             |:.:|.:|.|...|......:|:.|:.|.|:|
Mouse   855 KGNQ-----------------------------LREQNLLDKAFESYEAAVTLDPDQAQAWMNMG 890

  Fly   291 LCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYM 355
                       .|..::.|                 |:::..|......|.....|.|:|     
Mouse   891 -----------GIRHIQGS-----------------YVSARAYYERALKLVPDSKLLKEN----- 922

  Fly   356 LLGLCLRKLDDME 368
                 |.|||.:|
Mouse   923 -----LAKLDRLE 930

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 21/95 (22%)
TPR repeat 68..95 CDD:276809 8/26 (31%)
TPR_12 97..175 CDD:290160 19/110 (17%)
TPR repeat 100..130 CDD:276809 11/29 (38%)
TPR repeat 136..175 CDD:276809 5/38 (13%)
TPR repeat 179..209 CDD:276809 10/29 (34%)
TPR_19 190..254 CDD:291240 12/63 (19%)
TPR repeat 214..242 CDD:276809 4/27 (15%)
TPR repeat 249..277 CDD:276809 5/27 (19%)
TPR_11 283..348 CDD:290150 10/64 (16%)
TPR repeat 283..311 CDD:276809 6/27 (22%)
TPR repeat 316..346 CDD:276809 3/29 (10%)
TPR repeat 351..377 CDD:276809 5/18 (28%)
Tmtc1NP_945318.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..285
DUF1736 351..425 CDD:285594
TPR_11 542..605 CDD:290150
TPR 1 543..576
TPR_2 543..576 CDD:285020
TPR repeat 543..571 CDD:276809
TPR repeat 576..603 CDD:276809
TPR 2 577..607
TPR 577..607 CDD:197478
TPR_17 596..628 CDD:290167
TPR 3 608..641
TPR repeat 608..636 CDD:276809
TPR 621..940 CDD:223533 69/338 (20%)
TPR 4 642..675
TPR repeat 642..670 CDD:276809
TPR repeat 675..705 CDD:276809 9/31 (29%)
TPR 5 676..709 11/35 (31%)
TPR 6 710..742 0/31 (0%)
TPR repeat 710..738 CDD:276809 0/27 (0%)
TPR_7 715..744 CDD:289919 1/28 (4%)
TPR 7 743..776 11/32 (34%)
TPR repeat 743..771 CDD:276809 11/27 (41%)
TPR_14 749..786 CDD:290164 13/37 (35%)
TPR repeat 776..806 CDD:276809 6/40 (15%)
TPR 8 811..844 12/32 (38%)
TPR repeat 812..839 CDD:276809 8/26 (31%)
TPR repeat 844..878 CDD:276809 9/64 (14%)
TPR 9 849..882 9/63 (14%)
TPR 10 883..916 9/60 (15%)
TPR_1 883..915 CDD:278916 9/59 (15%)
TPR repeat 883..911 CDD:276809 8/55 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.