DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc3

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_477246.2 Gene:Tmtc3 / 37401 FlyBaseID:FBgn0020312 Length:926 Species:Drosophila melanogaster


Alignment Length:418 Identity:81/418 - (19%)
Similarity:175/418 - (41%) Gaps:62/418 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIDWLLHIYFTRREFTRCRRLIERELNRHLNPE--YLYFVQGLIDREEGNHIEALRHLQKSAELN 97
            |:||       |.|::.....:      |:|..  .||...|.....||...|||.:.|::..:.
  Fly   493 NLDW-------RTEYSLFMSGV------HVNQRNAKLYNNVGHALENEGKFEEALLYFQQAVRIQ 544

  Fly    98 PRNIETYKEIGRTLYIMGRFS-------QALGVFREAE------QRSSRQDHEIYHYLGELLYRA 149
            ..:|..:..:|||...:.|::       ||..:|.:|:      .|.:.....::..|..|:.:.
  Fly   545 TDDIGAHINVGRTFNNLKRYAEAEQAYVQAKALFPQAKPGVSYHARIAPNHLNVFINLANLIAKN 609

  Fly   150 ATTQSQKDVASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENS 214
            .|...:.|...:|....|:.:         :::|:...::..|..:..:|.|:.|..|....||:
  Fly   610 QTRLEEADHLYRQAISMRSDY---------VQAYINRGDILMKLNRTAQAQEVYEQALLYDNENA 665

  Fly   215 EVLIEISVLYLKINETQKAHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDG------ALSKYS 273
            ::...:.|::|:..::|:|.....:.:.:..: ..:.||....:||   ::.|      :.|:..
  Fly   666 DIYYNLGVVFLEQGKSQQAQVYFNKAIELYPE-HEQALLNSAILLQ---ELGGEEARRVSRSRLY 726

  Fly   274 QIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFH 338
            ::...:.:..:::.|:|:....:..|..|....::::.|.....:||:||:|:...:::...|..
  Fly   727 KVLENDDQNEKVYFNLGMLAMDESSFDEAEQFFKRAIHLKADFRSALFNLALLLADTKRPLDAVP 791

  Fly   339 TLAAAINLRKDNAECYMLLGLC----LRKLDDMENAFVALERASSMATGQQGAGRNPLVVLNFAL 399
            .|...|.....:.:..:|||..    ::.||:.|..:.::.......|  ||       :.|..:
  Fly   792 FLNQLIRHHPSHVKGLILLGDIYINHMKDLDEAEKCYRSILHYDPHNT--QG-------LHNLCV 847

  Fly   400 FCYETGRLALSTE--QYNRFMSQAQDLL 425
            ...|..|||.:..  ||.:.::.|:|.:
  Fly   848 VFVERKRLAKAAACLQYAQRLAPAEDYI 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 19/72 (26%)
TPR repeat 68..95 CDD:276809 9/26 (35%)
TPR_12 97..175 CDD:290160 16/90 (18%)
TPR repeat 100..130 CDD:276809 9/42 (21%)
TPR repeat 136..175 CDD:276809 6/38 (16%)
TPR repeat 179..209 CDD:276809 6/29 (21%)
TPR_19 190..254 CDD:291240 12/63 (19%)
TPR repeat 214..242 CDD:276809 4/27 (15%)
TPR repeat 249..277 CDD:276809 6/33 (18%)
TPR_11 283..348 CDD:290150 13/64 (20%)
TPR repeat 283..311 CDD:276809 4/27 (15%)
TPR repeat 316..346 CDD:276809 8/29 (28%)
TPR repeat 351..377 CDD:276809 6/29 (21%)
Tmtc3NP_477246.2 DUF1736 323..396 CDD:369859
PEP_TPR_lipo <513..871 CDD:274350 72/379 (19%)
TPR repeat 514..542 CDD:276809 9/27 (33%)
TPR repeat 547..591 CDD:276809 9/43 (21%)
TPR repeat 598..625 CDD:276809 5/26 (19%)
TPR repeat 630..660 CDD:276809 6/38 (16%)
TPR repeat 665..693 CDD:276809 4/27 (15%)
TPR repeat 737..764 CDD:276809 4/26 (15%)
TPR repeat 803..834 CDD:276809 6/30 (20%)
TPR repeat 839..867 CDD:276809 10/36 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467055
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.