DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and sxc

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_523620.1 Gene:sxc / 35486 FlyBaseID:FBgn0261403 Length:1059 Species:Drosophila melanogaster


Alignment Length:439 Identity:92/439 - (20%)
Similarity:160/439 - (36%) Gaps:113/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEI 138
            |.:...:|....|:.|.:|:..|:|..::.|..:|..|.....|.:|:..:..|...|  .::.:
  Fly   227 GCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALNLS--PNNAV 289

  Fly   139 YHYLGELLYRAATTQSQKDVASQQQDEARTYFE-----LAVQSGRKL--------ESYVRLAELY 190
            .|  |.|                    |..|:|     ||:.:.|:.        ::|..||...
  Fly   290 VH--GNL--------------------ACVYYEQGLIDLAIDTYRRAIELQPNFPDAYCNLANAL 332

  Fly   191 RKDKQYQKAIEILENCLHLTPENSEVL-------------IEISVLYLKINET----QKAHDRLA 238
            ::..|.::|.:.....|.|...:::.|             .|.:.||||..|.    ..||..||
  Fly   333 KEKGQVKEAEDCYNTALRLCSNHADSLNNLANIKREQGYIEEATRLYLKALEVFPDFAAAHSNLA 397

  Fly   239 EVVSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAI 303
                              ::||.:..:..||..|.:....:|..|:.::|:|....:.|....|:
  Fly   398 ------------------SVLQQQGKLKEALMHYKEAIRIQPTFADAYSNMGNTLKELQDVSGAL 444

  Fly   304 SSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDME 368
            ....:::.::|...:|..||:.|:..|.....|..:...|:.|:.|..:.|..|..||:.:.|..
  Fly   445 QCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIQSYRTALKLKPDF
PDAYCNLAHCLQIVCDWT 509

  Fly   369 NAFVALERASSMATGQQGAGRNP------------------LVVLNFALFCYETGRLALSTEQYN 415
            :..:.:::..|:.|.|....|.|                  .:....|..|.|...: |..:.||
  Fly   510 DYDIRMKKLVSIVTEQLEKNRLPSVHPHHSMLYPLTHDCRKAIAARHANLCLEKVHV-LHKKPYN 573

  Fly   416 RFMSQAQDLLLPTEYKFQATKLKSLLRISNQGNGILLDSADMGESDLGH 464
             |:.:     |||         |..|||     |.|  |:|.|.....|
  Fly   574 -FLKK-----LPT---------KGRLRI-----GYL--SSDFGNHPTSH 600

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 12/52 (23%)
TPR repeat 68..95 CDD:276809 5/20 (25%)
TPR_12 97..175 CDD:290160 16/82 (20%)
TPR repeat 100..130 CDD:276809 6/29 (21%)
TPR repeat 136..175 CDD:276809 8/43 (19%)
TPR repeat 179..209 CDD:276809 6/37 (16%)
TPR_19 190..254 CDD:291240 15/80 (19%)
TPR repeat 214..242 CDD:276809 11/44 (25%)
TPR repeat 249..277 CDD:276809 5/27 (19%)
TPR_11 283..348 CDD:290150 14/64 (22%)
TPR repeat 283..311 CDD:276809 5/27 (19%)
TPR repeat 316..346 CDD:276809 7/29 (24%)
TPR repeat 351..377 CDD:276809 5/25 (20%)
sxcNP_523620.1 TPR repeat 53..78 CDD:276809
TPR_11 86..149 CDD:290150
TPR repeat 86..112 CDD:276809
TPR_11 118..183 CDD:290150
TPR_1 118..151 CDD:278916
TPR repeat 118..146 CDD:276809
TPR repeat 151..181 CDD:276809
TPR_12 182..252 CDD:290160 6/24 (25%)
TPR_1 192..219 CDD:278916
TPR_1 220..253 CDD:278916 7/25 (28%)
TPR repeat 220..248 CDD:276809 5/20 (25%)
TPR 233..490 CDD:223533 60/298 (20%)
TPR_1 255..287 CDD:278916 7/33 (21%)
TPR repeat 255..282 CDD:276809 6/26 (23%)
TPR repeat 287..317 CDD:276809 9/51 (18%)
TPR_1 288..321 CDD:278916 9/54 (17%)
TPR_17 310..342 CDD:290167 5/31 (16%)
TPR repeat 322..350 CDD:276809 5/27 (19%)
TPR repeat 355..385 CDD:276809 6/29 (21%)
TPR_10 356..>385 CDD:290111 6/28 (21%)
TPR_1 390..423 CDD:278916 10/50 (20%)
TPR repeat 390..418 CDD:276809 9/45 (20%)
TPR repeat 423..453 CDD:276809 5/29 (17%)
TPR_1 424..455 CDD:278916 5/30 (17%)
TPR_1 458..491 CDD:278916 8/32 (25%)
TPR repeat 458..486 CDD:276809 7/27 (26%)
Glyco_transf_41 584..1044 CDD:290556 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.