Sequence 1: | NP_610636.1 | Gene: | BBS4 / 36167 | FlyBaseID: | FBgn0033578 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609491.1 | Gene: | CG14921 / 34547 | FlyBaseID: | FBgn0032345 | Length: | 240 | Species: | Drosophila melanogaster |
Alignment Length: | 206 | Identity: | 43/206 - (20%) |
---|---|---|---|
Similarity: | 74/206 - (35%) | Gaps: | 71/206 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 RLIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFS 118
Fly 119 QALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRK---- 179
Fly 180 -LESY--VRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVV 241
Fly 242 SI--ERKCSPK 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BBS4 | NP_610636.1 | TPR_12 | 63..127 | CDD:290160 | 13/63 (21%) |
TPR repeat | 68..95 | CDD:276809 | 8/26 (31%) | ||
TPR_12 | 97..175 | CDD:290160 | 10/77 (13%) | ||
TPR repeat | 100..130 | CDD:276809 | 4/29 (14%) | ||
TPR repeat | 136..175 | CDD:276809 | 5/38 (13%) | ||
TPR repeat | 179..209 | CDD:276809 | 10/36 (28%) | ||
TPR_19 | 190..254 | CDD:291240 | 12/63 (19%) | ||
TPR repeat | 214..242 | CDD:276809 | 4/27 (15%) | ||
TPR repeat | 249..277 | CDD:276809 | 2/2 (100%) | ||
TPR_11 | 283..348 | CDD:290150 | |||
TPR repeat | 283..311 | CDD:276809 | |||
TPR repeat | 316..346 | CDD:276809 | |||
TPR repeat | 351..377 | CDD:276809 | |||
CG14921 | NP_609491.1 | p23_DYX1C1_like | 4..81 | CDD:107226 | 17/73 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |