DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and IFIT1

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001257856.1 Gene:IFIT1 / 3434 HGNCID:5407 Length:478 Species:Homo sapiens


Alignment Length:414 Identity:84/414 - (20%)
Similarity:155/414 - (37%) Gaps:97/414 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIDWLLHIYFTRREFTRCRRLIERELN--RHLNPEYLYFVQ-GLIDREEG---------NHIEAL 87
            |..|:   |:........:..:::..|  :.|:..:.|.:: ..||.|||         |:..|.
Human   100 NFAWM---YYHMGRLAEAQTYLDKVENICKKLSNPFRYRMECPEIDCEEGWALLKCGGKNYERAK 161

  Fly    88 RHLQKSAELNPRNIETYKEIGRTLYIMGRFSQA--------LGVFREAEQRSSRQDHEIYHYLGE 144
            ...:|..|::|.|.|:......:.|.:..|..|        |...|:|.:.:....     |:..
Human   162 ACFEKVLEVDPENPESSAGYAISAYRLDGFKLATKNHKPFSLLPLRQAVRLNPDNG-----YIKV 221

  Fly   145 LLYRAATTQSQKDVASQQQDEARTYFELAVQSGRKLESYV--RLAELYRKDKQYQKAIEILENCL 207
            ||  |...|.:     .|:.|...|.|.|: :....::||  ..|:.||:.....||:|:|:..|
Human   222 LL--ALKLQDE-----GQEAEGEKYIEEAL-ANMSSQTYVFRYAAKFYRRKGSVDKALELLKKAL 278

  Fly   208 HLTPENSEVLIEISVLYLKINETQKAHDRLAEVVSIER--KCSPKGLLAFGAILQSRNDID---- 266
            ..||.:..:..:|.:.|            .|:::.|:.  |..|:|        |:|..:|    
Human   279 QETPTSVLLHHQIGLCY------------KAQMIQIKEATKGQPRG--------QNREKLDKMIR 323

  Fly   267 GALSKYSQIANAEP--EIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIA 329
            .|:..:......:|  |:|.|  ::...:.:......|..:.:|.:.:.|:....:.::...|..
Human   324 SAIFHFESAVEKKPTFEVAHL--DLARMYIEAGNHRKAEENFQKLLCMKPVVEETMQDIHFHYGR 386

  Fly   330 SEQYA------SAFHTLAA------------AIN------LRK-----DNAECYMLLGLCLRKLD 365
            .:::.      :..|.|.|            :||      |||     .:.|...|||...:...
Human   387 FQEFQKKSDVNAIIHYLKAIKIEQASLTRDKSINSLKKLVLRKLRRKALDLESLSLLGFVYKLEG 451

  Fly   366 DMENAFVALERASSMATGQQGAGR 389
            :|..|....|||..:|...:.:.|
Human   452 NMNEALEYYERALRLAADFENSVR 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 19/81 (23%)
TPR repeat 68..95 CDD:276809 9/36 (25%)
TPR_12 97..175 CDD:290160 19/85 (22%)
TPR repeat 100..130 CDD:276809 8/37 (22%)
TPR repeat 136..175 CDD:276809 10/38 (26%)
TPR repeat 179..209 CDD:276809 10/31 (32%)
TPR_19 190..254 CDD:291240 16/65 (25%)
TPR repeat 214..242 CDD:276809 3/27 (11%)
TPR repeat 249..277 CDD:276809 6/31 (19%)
TPR_11 283..348 CDD:290150 12/88 (14%)
TPR repeat 283..311 CDD:276809 4/27 (15%)
TPR repeat 316..346 CDD:276809 6/53 (11%)
TPR repeat 351..377 CDD:276809 7/25 (28%)
IFIT1NP_001257856.1 TPR 1 52..85
TPR_12 54..127 CDD:290160 4/29 (14%)
TPR repeat 54..80 CDD:276809
TPR 2 95..128 4/30 (13%)
TPR repeat 97..123 CDD:276809 3/25 (12%)
TPR repeat 128..170 CDD:276809 10/41 (24%)
TPR 3 139..174 10/34 (29%)
TPR 4 183..216 6/32 (19%)
TPR repeat 216..246 CDD:276809 10/42 (24%)
TPR 5 218..249 10/38 (26%)
TPR 6 251..284 12/32 (38%)
TPR repeat 252..279 CDD:276809 9/26 (35%)
Interaction with the 5'-triphosphate group of PPP-RNA. /evidence=ECO:0000250 256..262 1/5 (20%)
TPR repeat 284..335 CDD:276809 11/70 (16%)
TPR 7 305..339 8/41 (20%)
TPR 8 340..373 6/34 (18%)
TPR repeat 340..367 CDD:276809 5/28 (18%)
TPR 9 378..412 4/33 (12%)
TPR repeat 378..407 CDD:276809 4/28 (14%)
TPR 10 437..470 10/32 (31%)
TPR repeat 437..465 CDD:276809 9/27 (33%)
TPR_1 438..470 CDD:278916 10/31 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.